Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041698 (Slco1a1)
Chromosomal location
Chr 6: 141856374 - 141895316 (-)
Description
solute carrier organic anion transporter family, member 1a1 Gene [Source:MGI Symbol;Acc:MGI:1351891]
Human Ortholog
not available
Omim not available
UniTrap UNI36217
Vector Insertion
Chr 6: 141871486 - 141873022
Public Clones IST12055D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042119
Sequence
CAATAGAAACTCTGACTAAGGCACTCTATCCTTAAGAGAGATTTTTTGGGGGGATGACTCGTTACAGTTCAGAAAATAATTTATTTAACAGCTTTCTCTG

AGAAAGACAGCAGTAGGACTTTTAAAGCAAAGAAACTGGAAACATTTGAAGAACACCATGGAAGAAACAGAGAAAAAGGTTGCAACACAAGAAGGCAGAT

TCTTCTCCAAGATGAAG GTGTTTCTGATGTCATTAACATGTGCATACCTAGCCAAATCACTATCAGGAGTTTATATGAATTCCATGCTCACACAAATAG

AGAGACAATTTGGTATCCCTACATCTGTAGTTGGATTTATCACTGGGAGCTTTGAGATAG GAAACCTTTTGTTGATTGTATTCGTGAGTTATTTTGGAA

GGAAACTGCACAGACCTATCATTATTGGTGTTGGATGTGTGGTTATGGGCCTGGGGTGTTTCTTAATGGCATCACCTCATTTCCTCATGGGCAG ATACA

AATATGAAACAACAATATCACCTACAAGCAACTTGTCCTCAAACAGCTTCTTGTGTATAGAAAACAGAACACAGACCTTAAAGCCAACGCAAGATCCAAC

AG AGTGTGTAAAAGAAATAAAATCATTAATGTGGATATATGTACTAATAGGAAATACTATGCGTGGAATTGGTGAAACTCCCATAATGCCCTTGGGTAT

TTCTTACATCGAAGACTTTGCCAAATCAGAAAACTCTCCTTTATATATTG GGATTTTAGAAATGGGGAAGATTGTTGGCCCGATTATTGGACTTTTGTT

GGGATCTTTCTTTGCACGTGTTTATGTAGACATTGGGTCTGTGAATACAG ATGACCTGACCATAACTCCCACTGATACACGCTGGGTCGGTGCTTGGTG

GATTGGCTTTTTGGTCTGTGCAGGAGTGAATATCCTGACCAGCATCCCCTTTTTCTTCTTTCCAAAGACACTGCCAAAGAAAGAACTACAGGATAATGTG

GATGTGACTAAATATGAGAAAGTTGAAAAACATAGAGAAAGAGCCAAAAAGGAAAACCTTGGAATCACTAAAG - UNI36217 - ATTTCTTGCCATT

CATGAAGAGCCTCTGCTGCAATCCTATTTATATGCTGTTCAGTCTTACGAGTGTGCTCCAGATAAATGGATTTGCCAGTACATTTACCTTCTTGCCCAAA

TACCTGGAGCAGCAATATGGAAAATCCACTTCAGAGGCAGTATTCCTCATAG - UNI36217 - GTGTTTATAGCTTGCCTCCAGTATGCCTTGGATA

TTTAATCAGTGGCTTTATTATGAAGAAGTTTAAGATCACTGTCAAGAAAGCTGCATACATAGCATTTGGCCTGTCCTTATCTGAATATTTTATTTTTCTC

TGTAACTATTTGTTGACCTGTGATAATTTCCCAGTTGCTGGATTAACCACCTCTTATAAAGG - UNI36217 - AGTTCAGCACCCTCTATATGGGGA

GAAAAATGTCCTTGCTGACTGCAACACAAGGTGCAGCTGCTTAACGGACACATGGGATCCAGTGTGTGGGGACAATGGCCTAGCTTACATGTCAGCCTGC

CTCGCAGGCTGTGAGAAGTCTGTTGGAACTGGAACCAACATG GTGTTTCAAAATTGCAGCTGCATTGGGTCATCAGGAAACTCATCTGCAGTCCTGGGG

CTGTGTAAGAAAGGCCCTGAGTGTGACAACAAGCTGCAGTACTTTTTAATCAAGTCAGTATTTTCCAGTTTCATCTTCTCACTCGCAGCCATCCCTGGAT

ACATGGTTCTTCTGAG GTGTGTCAAATCTGAAGAGAAGTCAATTGGAGTTGGATTACATGCATTTTTCATAAGACTATTAG CTGGCATTCCGGCACCT

GTTTACTTTGGCGCTTTGATAGACAGAACCTGTTTACATTGGGGAACTCTGAAATGTGGTCAACCAGGGGCATGCAGGATGTATGATATAAACAGATTCA

G GCACATTTACCTGGGGTTGCCTGCAGCAGTGAGAGGATCAAGCTTTCTCCCCGCAGTCTTCATTCTAATCCTTATGAGGAAATTCCATTTCCCTGGCG

ACATCCACTCTCCAGACACTGAACTTGCAGAGATGAAGCTCACAGAGAAGGAAAGCGAGTGCACAGATGTGTGCAGAAGTCCTAAGGTCGAGAACGATGG

AGAACTGAAAACTAAGCTGTAATGAGTTTTCAACTGGCCTGTGCAAGGCCATGAATGGAATGTACACTTCACTTTCTTTGAATCATGAGAGATATAGTAG

GAATCCTCATCTTTAAGGACCTCAACAATTATTTTTTACTCATAATAAAAAACAATTACTGATAGCAGTTTCAGAACATTAAGGTACTACTTCAGATTTT

CTCAGATTAGACATCTACGGTGACGCACACACTGAACTTTAAAGCTTCCTTCATTTTCACATGGCATTTTCTCTTTTAACTCAATCAAGGGGAGTTGTGT

TTCCTACATATCTTCAAATGGGTTTAAAGTTTTCCTATTCCTGAAACAGCATTCAATTCTACTGAATTTATCCTTCAATGTTGGAGGTATTTAGAACTGA

AAATATGCATTCTGGTTGGGACACATTGAAAAAGTTATCTTTTCTATGTTCAAGATGTCTGCATAGGTCTATATCTAGGAGTTTTCAATTTTTTATTATT

TTAGACATGAGTTTCTAGGATTAGACATCTTTCTCATGTGTCATCTTCTGTTTTCAGTCTCTCCTTTGTTTAGCCCTGTCACACATTTGATAATTTTGTT

TAGAGCACTGACAAACTTAGTCGGGTTATTAAAAATCACATTGCAAAGCTTGTTGGACCCATTTTCCCTAGCAACTCAAAGTCGTTCATGAAAATCTTTC

TTCAAAGCAACTATTTGAGAAAGCCAGTTATTTCAAAGGTTCTTTGTAAAGATGTAGTTGTTCCTCAGCTGTACAATGATTGCCTAGCATGTGTGCAACC

CTGCATTGAACCAAAAGGTAGAGTAGACTACTGACAATAATAGACAAAATAAAGTAAAATAAGAAATAAATGAAAATAAATCAGAGCTGGATGCAGTAGA

AGATATTCTCAAAGACTACTTTCTTATACTCAGGATGCCTCTGACTCAGTGGTCATTTTTTTCATGTGTCCTCAGAACACATGAATAAAATGATAACATA

TTTAAAAGTATAACTATAATTTTATAATAAATTATAATAAAGTTATAAATTTACAATTAAAATTAAACTATAACATGAAT
Translation
MEETEKKVATQEGRFFSKMK VFLMSLTCAYLAKSLSGVYMNSMLTQIERQFGIPTSVVGFITGSFEIG GNLLLIVFVSYFGRKLHRPIIIGVGCVVMG

LGCFLMASPHFLMGR RYKYETTISPTSNLSSNSFLCIENRTQTLKPTQDPTE ECVKEIKSLMWIYVLIGNTMRGIGETPIMPLGISYIEDFAKSENSP

LYIG GILEMGKIVGPIIGLLLGSFFARVYVDIGSVNTD DDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKKELQDNVDVTKYEKVEK

HRERAKKENLGITKD - UNI36217 - DFLPFMKSLCCNPIYMLFSLTSVLQINGFASTFTFLPKYLEQQYGKSTSEAVFLIG - UNI36217 - G

VYSLPPVCLGYLISGFIMKKFKITVKKAAYIAFGLSLSEYFIFLCNYLLTCDNFPVAGLTTSYKG - UNI36217 - GVQHPLYGEKNVLADCNTRCS

CLTDTWDPVCGDNGLAYMSACLAGCEKSVGTGTNM VFQNCSCIGSSGNSSAVLGLCKKGPECDNKLQYFLIKSVFSSFIFSLAAIPGYMVLLR RCVKS

EEKSIGVGLHAFFIRLLA AGIPAPVYFGALIDRTCLHWGTLKCGQPGACRMYDINRFR RHIYLGLPAAVRGSSFLPAVFILILMRKFHFPGDIHSPDT

ELAEMKLTEKESECTDVCRSPKVENDGELKTKL

For any suggestions or comments, please send an email to unitrap@crg.es