Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041702 (Btbd7)
Chromosomal location
Chr 12: 104022866 - 104116616 (-)
Description
BTB (POZ) domain containing 7 Gene [Source:MGI Symbol;Acc:MGI:1917858]
RefSeq_dna
NM_172806 
RefSeq_peptide
NP_766394.2 
MGI
MGI:1917858 
Uniprot/SWISSPROT
Q8CFE5 
Human Ortholog
ENSG00000011114 (BTBD7)
Omim not available
UniTrap UNI16560
Vector Insertion
Chr 12: 104078498 - 104079248
Public Clones not available
Private Clones OST458391 (lexicon) OST455640 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045652
Sequence
AATGGCGACGGGGGGAACCTGGAGTGGTCCCGGAGCCTAAGCCACTGACAGGAGAGGGGAGGGCGGCGGCGGCGGCTGGAGGAGAATGGCCGCGGGGGCT

GGCGCCAGTGCGGACGACGGCGCTGGGGGCGGCGGCGGCGGAGGCGACGGCAGCGGTCCCAGCAGCAGTCGCGGCGGGAGGAGCCTCCGAG GGTTTATG

GGAAAGATAAACTAAAGCGTTGTTTTTGACTGGGCCTGATGATGCAAGCCTGTTATCCCAGCTCCTTAGGAGGCAGAGGCAGGAAGATGGCAAGTTCAAG

GGCAGCCTGAATAACAGCCATACCGTGTCTCAAAGTTTTTAAAAG - UNI16560 - AAATGGATGAAAAGAGGCTACTGGATCCAGGGTTGAAGGTT

CGTAAAGGCCTCTGGGATTACCCTCTGAAGAACCAGCAGATGGAATGCCGGAGTGACTGAAAAAAATGGGTGCTAATGCATCTAACTATCCTCATTCATG

TTCCCCAAGGGTAGGGGGAAATTCACAGGCCCAGCAGACTTTCATAG GAACATCTTCCTATTCTCAACAAGGCTATGGTTGTGAGTCAAAGTTGTATAG

CCTTGACCATGGCCATGAGAAACCACAAGACAAAAAAAAGAGAACCTCTGGCCTTGCCACTCTCAAAAAGAAGTTTATTAAACGCCGAAAATCTAATAGA

TCGGCTGATCACGCCAAGCAGATGCGAGAACTCCTCTCTGGGTGGGATGTTAGAGATGTCAATGCACTAGTGGAAGAATATGAGGGAACTTCAGCCTTGA

AGGAGCTTTCTCTGCAAGCCAGTTTGGCTAGGCCAGAAGCTCGGACCCTGCAGAAGGACATGGCCGACCTTTATGAGGATAAGTACTGTACTGACGTGGA

CTTAATATTTCAGGAAACTTGTTTTCCTGTTCACCGTGCCATTTTGGCAGCAAGGTGTCCATTTTTTAAAACCCTGCTTTCTTCTTCACCTGAGTATGGG

GCAGAGATAATAATGGACATCAGTACAGCTGGTATTGATATGCCCATGTTTTCCGCCTTGTTACACTACCTTTATACAGGAGAGTTTGGAATGGAGGACT

CAAGATTTCAGAATGTCGACATCCTTGTTCAGCTTAGTGAAGAATTTGGAACACCAAATCCCCTTGATGTAGATATGCGTGGACTCTTTGATTACATGTG

TTATTATGATGTTGTCCTTAGTTTTTCTTCAGATTCTGAACTAGTTGAAGCTTTTGGTGGAAATCAGAACTGTTTAGATGAAGAGCTCAAAGCCCACAAG

GCTATTATTTCTGCACGGTCCCCGTTTTTCCGAAATTTATTACAAAGGAGAATACGGACTGGTGAAGAAATCACAGACCGAACTTTGAGAACTCCCACAA

GAATTATATTAGATGAGTCCATTATACCAAAAAAATATGCAAAAGTGATATTACACTGTATGTATACCGATGTGGTGGACCTCTCTGTTTTACACTGTAG

CCCCTCTGTGGGGAGTCTCAGTGAAGTTCAGGCTCTCGTCGCAGGGAAGCCAAACATGACCAGGGCAGAAGAAGCCATGGAACTTTACCACATAGCACTA

TTCTTGGAATTTAACATGCTTGCACAAG GCTGTGAGGACATCATTGCTGAGAGCATCTCATTAGACACCTTAATTGCCGTCCTCAAGTGGAGCTCGCAT

CCATACGGCTCTAAGTGGGTGCACCGACAAGCTGTGCATTTCCTGTGTGAGGAGCTATCCCAGGTCATGACTTCGGATGTTTTTTATGAACTGAGCAAAG

ACCATCTGCTTACTGCTATCCAGTCTGACTACCTACAG GCAAGCGAACAAGATATCCTTAAATATCTGATTAAATGGGGTGAGCATCAGTTGATGAAAA

GAATAGCAGACAGAG AGCCAAACTTACTGAGTGGCACTGCACATAGTGTGAACAAAAGAGGTGTGAAGAGAAGAGACCTGGACATAGAAGAACTTAGAG

AGATCCTTTCTTCTCTCTTGCCTTTTGTGCGGATTGAACACATCCTACCTATAAACAGTGAGGTCTTAAGTGATGCA ATGAAAAGAGGCTTGATCAGCA

CGCCGCCATCAGACATGCTTCCTACAGCAGAGGGCGGGAAATCAAACGCCTGGCTGCGGCAGAAGAACGCTGGCATATATGTTCGTCCTCGGCTGTTTTC

TCCCTATGTGGAGGAAGCAAAG TCAGTGCTGGATGAGATGATGGTGGAACAGACAGACCTGGTGCGACTGCGAATGGTGCGCATGTCCAATGTCCCAGA

CACACTCTACATGGTCAGCAATGCCATGCCCCAGTGCTGCCACATGATCAGCCACCAGCAGATCAGCAGTAACCAGTCGAGCCCTCCATCAGTTGTAGCC

AATGAGATCCCAG TTCCTCGTCTCCTCATTATGAAGGATATGGTGAGGCGCCTGCAGGAACTGCGGCACACAGAGCAGGTGCAGAGAGCCTATGCACTG

AACTGTGGGGAAGGTGCCACCGTCAGCTATGAAATCCAGATCCGAGTGCTCAGAGAGTTTGGTCTTGCAGACGCCGCTGCAGAGCTCCTACAG AATCCT

CACAAGTTCTTTCCTGATGAACGGTTTGGGGATGAAAGTCCGCTCTTGACAATGAGGCAGCCTGGGAGATGTCGTGTCAACAGTACCCCTACTGCAGAAA

CCATGTTTACAGACCTGGACTCTTTTGTGGCCTTCCATCCACCTTTACCCCCTCCGCCCCCTCCGTACCACCCTCCAGCTACTCCAATCCATAACCAGCT

CAAGGCAGGCTGGAAGCAAAGGCCTCCCAGTCACCACCCTTCCCGTTCATTTTCTTACCCCTGTAATCATTCACTGTTTCACTGCAGAACAGCTCCTAAA

CCTGGCCCTCCCCCAGTCTATTTGCCAGGTGTTAAAGTAGCCCCTCCCGACTGCACCAACACCACAGGCCTGGGGAGACAGACGGTTGCTGCTGCTGCTG

CAGCTGCTGCCGCCTCAGCAGCAATAATACCTGAGAAGCAAGTG TGTCCACAGCCTGTGCTGAATGACCTGATGCCAGATATCGCCATGGGGGTGTCTA

CACTGTCACTCAAGGACAGGAGGCTCCCAGAGCTCGCTGCAGACACAGAGTTATGCCAGACAGTTTCTGAAGCAGGAACGGGACCTCCCCAGCATCTGTC

ATGTATTCCACAGAGACACACAAACACATCTCGAAAAAAACCCACACTAGAGCAGAAAGCAGACGGTAGAGAAAATCAGCAGGAATACCCAGATCTCTAT

GACTTCTCAAATGCTGCTTGCAGACCTTCCACTCCTGCTCCTGGCAGACACTCCCCTTCCCCTGCTCATGGTAGATACTTTGGTCCAGACTTGTACAGCC

ACAATAAGGCATCACCAAATGGCTTAAAGTCAGTTTACCTACCTGGTCAGACCTCTCCTAAAAAGCAGGAAGACCCTAGGAGAGAGTACCCACCGTCTCC

TGACGGCCATCCGCACAGGCAGAAGAGGGAGCCGATACGTCTGGACGTGGTTGAGCAGCCTCCCCAGAGGCCAGACTTTCCTTCCGCAGCCTCAGAAAAT

GCTAGTCATGGTCCAGCCCATGTCAGGGCACGGACTGCAGTAGAAACTGACTTGACTTTTGGGCTGACATCTAACAGACCTCCTTCCCATTCTGCGTGTA

GCTCTGAAGTTCTCGAAGAGCGATCCAGTAGACGACTGACAGACAGCGAGCCCCTGGGCCATGGAGCTCATCAAAGAAATGCAGATCTGGAAAGGGGTGA

TTCCATTAGCAGAGGACGGAGGTCGCCAAGCAAGCCAGACTTCCTCTACAAAAAGTCTGCCCTCTGAAGTAGCTTCCGAGTCTGTGCCTGAGATGTGAAA

CATCCTGTCTTATGATGTAACCCAACAACTTACTGACCGGTTTATCGACGCCAGCTCAGTTCCACATTTTATTCTAGCTTTTCTGTGTATATATGTTTAT

TATACATGGCATGCTAAGAGGGTTGTTTTGAATGCTGCATCTGTCTTTTGTGTTTAAAAGTTGTGTGGGGAACATCTTAAAGAGCAAGCAAGCTGGCACT

TTTTCTCCTTTACAGATGACTAACTTTTTGCACTTGTACATTTTATTTGTATTGATTTTATAACAGTGTGTTAAACTACTTTATTGCTACATTTAAAGGA

CTGTATTTTCATACTTTTTGCATTTTACCTATCATCTACCAGTTTCCATGTGCATTGGGTTGCACACTAAGATGTATTTTCTTACGAAATAGTTGTGTTT

ATTTTTTAATTATAGAAATTCC
Translation
  - UNI16560 - MGANASNYPHSCSPRVGGNSQAQQTFIG GTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKFIKRRKSNRSADHA

KQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLYEDKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIM

DISTAGIDMPMFSALLHYLYTGEFGMEDSRFQNVDILVQLSEEFGTPNPLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAIISA

RSPFFRNLLQRRIRTGEEITDRTLRTPTRIILDESIIPKKYAKVILHCMYTDVVDLSVLHCSPSVGSLSEVQALVAGKPNMTRAEEAMELYHIALFLEFN

MLAQG GCEDIIAESISLDTLIAVLKWSSHPYGSKWVHRQAVHFLCEELSQVMTSDVFYELSKDHLLTAIQSDYLQ ASEQDILKYLIKWGEHQLMKRIA

DRE EPNLLSGTAHSVNKRGVKRRDLDIEELREILSSLLPFVRIEHILPINSEVLSDA MKRGLISTPPSDMLPTAEGGKSNAWLRQKNAGIYVRPRLFS

PYVEEAK SVLDEMMVEQTDLVRLRMVRMSNVPDTLYMVSNAMPQCCHMISHQQISSNQSSPPSVVANEIPV VPRLLIMKDMVRRLQELRHTEQVQRAY

ALNCGEGATVSYEIQIRVLREFGLADAAAELLQ NPHKFFPDERFGDESPLLTMRQPGRCRVNSTPTAETMFTDLDSFVAFHPPLPPPPPPYHPPATPIH

NQLKAGWKQRPPSHHPSRSFSYPCNHSLFHCRTAPKPGPPPVYLPGVKVAPPDCTNTTGLGRQTVAAAAAAAAASAAIIPEKQV CPQPVLNDLMPDIAM

GVSTLSLKDRRLPELAADTELCQTVSEAGTGPPQHLSCIPQRHTNTSRKKPTLEQKADGRENQQEYPDLYDFSNAACRPSTPAPGRHSPSPAHGRYFGPD

LYSHNKASPNGLKSVYLPGQTSPKKQEDPRREYPPSPDGHPHRQKREPIRLDVVEQPPQRPDFPSAASENASHGPAHVRARTAVETDLTFGLTSNRPPSH

SACSSEVLEERSSRRLTDSEPLGHGAHQRNADLERGDSISRGRRSPSKPDFLYKKSAL

For any suggestions or comments, please send an email to unitrap@crg.es