Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041710 (Trpc5)
Chromosomal location
Chr X: 140816214 - 141122723 (-)
Description
transient receptor potential cation channel, subfamily C, member 5 Gene [Source:MGI (curated);Acc:Trpc5-001]
RefSeq_dna
NM_009428 
RefSeq_peptide
NP_033454.1 
UniGene
Mm.328378 
MGI
MGI:109524 
Uniprot/SWISSPROT
Q9QX29 
Uniprot/SPTREMBL
Q2KHN9 Q8C8A8 
Human Ortholog
ENSG00000072315 (TRPC5)
Omim not available
UniTrap UNI36597
Vector Insertion
Chr X: 140958006 - 141122724
Public Clones IST12233F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31259
Vector Insertion
Chr X: 140816213 - 140820527
Public Clones IST11663H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040184
Sequence
CGCTGAGGGGGGACAAGTGAGAGAGAAGAGAGAGAGAACCGGGCAGGAGCACACCGGGCAGTCGGGCGAAGAGAAGAGTTTCGGGCACTGGCAGAGGCAA

AAGGTGAGGAGATCTGGCCAGTCAGAGGGAAGTTTGGCAGTAACTGAAGAGCAAAGAAGGAAGCCCAGGTAGGAGTCAGTCCTTGGGCTCCTCTCAGCAT

CCTGATTCCTTCGCCAGTACTCAACCACCACCCACTCGGCAGCCTCCAGGCCCGGGACTGTCCCAGGTGGCTGCCGCTTGCGCGGCGCGGAAGAGGAGTC

CAGTAAGGTTGCCGCACCACGCGCCGGGGTGCTCGGACTCCAGACAACACAAATCTGAAAAAAAAAACACACTTGGCCTGGG - UNI36597 - TTTT

CTAAATTGTTATGAACCATGGCCCAGCTGTACTACAAGAAGGTCAATTACTCACCATACAGAGATCGCATCCCCCTCCAAATCGTGAGGGCTGAGACTGA

GCTGTCTGCTGAGGAGAAAGCCTTCCTTAGTGCTGTGGAGAAGGGGGACTATGCCACAGTGAAGCAGGCACTGCAGGAGGCCGAGATCTACTACAATGTC

AACATCAACTGCATGGATCCTTTGGGCAGGAGCGCCCTGCTCATTGCCATTGAGAATGAGAACTTGGAGATCATGGAGCTACTGCTGAACCACAGTGTGT

ATGTGGGCGATGCATTACTCTACGCCATCCGCAAGGAGGTGGTAGGAGCTGTGGAACTTCTGCTTAGCTACAGGAAGCCCAGTGGAGAGAAGCAG - UN

I36597 - GTTCCCACGCTGATGATGGACACCCAGTTCTCTGAGTTCACACCAGACATCACTCCCATTATGTTGGCAGCCCACACCAACAACTATGAAA

TCATCAAATTGCTTGTCCAAAAGAGGGTCACTATCCCAAGGCCCCACCAGATCCGCTGCAACTGTGTGGAGTGTGTATCCAGTTCGGAGGTAGATAGTCT

ACGTCATTCTAGGTCCCGACTGAATATATACAAGGCTCTGGCAAGCCCCTCGCTCATTGCCTTATCAAGCGAGGACCCCATCCTCACGGCCTTTCGGCTG

GGCTGGGAACTCAAGGAGCTGAGCAAAGTGGAAAATGAGTTCAAGGCTGAGTACGAGGAACTTTCCCAGCAATGTAAGCTCTTTGCCAAGGATCTCTTGG

ACCAAGCTCGGAGCTCCAGAGAACTGGAGATCATCCTCAACCATCGAGATGACCACAGTGAAGAACTTGACCCACAGAAGTATCATGACCTGGCCAAGCT

GAAGGTGGCAATCAAATATCACCAGAAAGAG TTTGTCGCTCAGCCAAACTGCCAACAATTGCTAGCCACCTTGTGGTACGATGGCTTCCCTGGATGGCG

GAGAAAACACTGGGTAGTCAAGCTTCTGACCTGCATGACCATTGGATTCCTGTTTCCTATGCTGTCCATAGCCTATCTGATCTCACCCAGAAGCAACCTT

GGGCTTTTCATCAAGAAACCCTTTATTAAGTTCATCTGCCACACAGCATCCTATCTGACCTTCCTCTTCATGCTTCTCCTGGCTTCTCAACATATCGTCA

GAACAGACCTCCATGTTCAAGGACCTCCCCCAACTGTTGTGGAATGGATGATACTGCCTTGGGTTCTAG GTTTCATTTGGGGGGAGATAAAGGAAATGT

GGGATGGTGGATTCACGGAATACATCCATGATTGGTGGAACCTGATGGATTTTGCAATGAACTCCCTCTACCTGGCAACTATTTCCTTGAAGATCGTGGC

CTATGTCAAG TATAATGGTTCTCGTCCAAGGGAAGAATGGGAAATGTGGCACCCGACTCTGATTGCAGAAGCACTCTTCGCAATATCCAACATTTTAAG

TTCCTTGCGTCTCATATCCTTGTTCACAGCCAACTCCCATTTAGGGCCTCTGCAGATCTCTTTGGGACGAATGCTGCTTGATATACTCAAATTTCTCTTT

ATCTACTGCCTAGTACTACTGGCTTTTGCCAACGGACTGAACCAGCTTTACTTTTACTATGAGACCAGAGCTATTGATGAACCTAACAACTGCAAGGGGA

TCCGATGTGAAAAACAGAACAACGCCTTCTCCAC GCTCTTTGAAACCCTTCAGTCGCTCTTCTGGTCTGTCTTTGGCCTCCTAAATCTCTATGTTACCA

ATGTGAAGGCCCGACATGAGTTCACTGAGTTTGTGGGAGCTACGATGTTTGGGACATACAACGTCATCTCCCTGGTAGTGCTGCTGAATATGCTCATCGC

CATGATGAACAACTCCTACCAGCTCATTGCC GATCATGCTGATATTGAGTGGAAGTTTGCGAGAACAAAGCTCTGGATGAGTTACTTTGATGAAGGTGG

CACCTTACCACCTCCTTTCAACATTATTCCCAGCCCCAAATCATTTCTCTATCTTGGCAACTGGTTCAACAACACCTTCTGTCCCAAAAGAGACCCTGAT

GGAAGACGAAGGAGGCACAACTTGAGAAGCTTCACA GAACGTCATGCTGACAGCCTGATACAAAATCAACATTATCAG - UNI31259 - GAAGTTA

TCAGAAATTTAGTCAAGAGATATGTGGCTGCAATGATAAGAAACTCCAAAACAAATGAGGGGCTAACAGAAGAAAATTTTAAG - UNI31259 - GAA

TTAAAGCAGGACATTTCCAGCTTTCGATATGAAGTGCTTGACCTCTTGGGAAACAGGAAACATCCAAGAAGAAGCCTCTCCACCAGCAGTGCTGATTTCT

CTCAAAGGGATGATACCAATGACGGCAGTGGTGGGGCTCGGGCCAAGTCTAAGAGTGTCTCTTTCAATGTAGGCTGCAAGAAAAAGGCCTGTCACGGTGC

ACCGCTCATCAGAACCGTGCCAAGAGCTAGTGGCGCCCAAGGAAAGCCAAAATCCGAGTCGTCGAGCAAACGGTCCTTCATGGGTCCGTCTTTCAAGAAA

TTGGGTCTCTTCTTCTCCAAGTTCAATGGTCAAACATCTGAACCTACTTCGGAGCCAATGTACACAATCTCTGATGGCATCGCACAGCAGCATTGTATGT

GGCAGGACATCCGCTATTCTCAGATGGAGAAAGGGAAGGCAGAGGCCTGTTCTCAAAGTCAGATGAACCTTGGCGAGGTAGAGCTAGGTGAAATCCGGGG

GGCTGCTGCTCGGAGCAGTGAGTGCCCCCTAGCCTGTTCCAGCTCCCTTCACTGTGCATCCGGCATCTGCTCCTCAAATTCGAAACTTTTGGACTCGTCA

GAGGACGTATTTGAAACTTGGGGAGAGGCTTGTGACTTGCTCATGCACAAATGGGGTGATGGACAGGAAGAACAAGTTACAACTCGGCTCTAAGTCAAAT

CCCCGTCATCTATTCTGGAATTCAAGAGAATATTTGTAATTTCCCTGTTCTCAGAGGTGACCCCAAATTTGGTTCCCTCCCTGTCCCCAACACACACACA

CACACACACACACACACACACACACACACACACACACACCAAGGAGTGAAACTCCTATTACTTTCAGTCTTTTCTAGCCACATTCTTCATGTTTTGTTTC

ACTGTCATTATCATTTGCCTTTTTATATCTATAAATACTAAATCCATCTCAAAAGCAACTGAAGGGGTCCTGCCCCTAATGAGCAGAGGTGCGGTCGGGT

GCTTTAACCCCTTTGCTTTGCTTTGTTCACCCTTGCCTCCTTGAAGCTCCAGGTGCCACTTTGCTACCATAGCTGCCGCATAGATTCCTGACATGCCTCA

GGATCTCACACCCATCTCCCCACAGAGCTGAGGGCTACGGTCAGCAGTCCCTACCAGCTATCAGATAAGGCTAATCAACCTGCCTGTCTTCGTTGCTCTT

CAGTGCTACACGCTGCCCATGCTGGTCCGATGAACAGCATTAAAGGGAGACTCCAAAGAATTGTCAGCTTGTGGTTTCTAGGTAGAACTGGCCTTTCCGT

TCCGTTTTTAAACACTACAAGTACTAATTGTGGGGACTGTAGAGGTTTTGTTTCGTAAATGTGTGTTAGTTTCTTAACGTGTAGCAATGAGATATTTACT

GTACAGTGCGTACCACATAATAAGTTAGCTAATTTCCTGTGTTTGTATATTTCGGTTAACTTACCATACCTTAAAATTTGAGAGTATCAAAACTAGTATT

TAGGATGTGTACTTTTTTCA
Translation
 - UNI36597 - MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIM

ELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQ - UNI36597 - VPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPH

QIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHR

DDHSEELDPQKYHDLAKLKVAIKYHQKE FVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHT

ASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLG GFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK YNGSRPREE

WEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFST 

TLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIA DHADIEWKFARTKLWMSYFDEGGTLPPPFNIIP

SPKSFLYLGNWFNNTFCPKRDPDGRRRRHNLRSFT ERHADSLIQNQHYQ - UNI31259 - EVIRNLVKRYVAAMIRNSKTNEGLTEENFK - UNI

31259 - ELKQDISSFRYEVLDLLGNRKHPRRSLSTSSADFSQRDDTNDGSGGARAKSKSVSFNVGCKKKACHGAPLIRTVPRASGAQGKPKSESSSKR

SFMGPSFKKLGLFFSKFNGQTSEPTSEPMYTISDGIAQQHCMWQDIRYSQMEKGKAEACSQSQMNLGEVELGEIRGAAARSSECPLACSSSLHCASGICS

SNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL

For any suggestions or comments, please send an email to unitrap@crg.es