Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041720 (Pi4ka)
Chromosomal location
Chr 16: 17280445 - 17406407 (-)
Description
phosphatidylinositol 4-kinase, catalytic, alpha polypeptide Gene [Source:MGI Symbol;Acc:MGI:2448506]
RefSeq_dna
NM_001001983 
RefSeq_peptide
NP_001001983.1 
UniGene
Mm.5718 
MGI
MGI:2448506 
Uniprot/SPTREMBL
Q3UVT5 Q6DIC7 Q7TNG2 Q80Y45 
Human Ortholog
ENSG00000215513 (PI4KAP1)
Omim not available
UniTrap UNI19437
Vector Insertion
Chr 16: 17389551 - 17406347
Public Clones (sanger)
Private Clones OST391157 (lexicon) OST352119 (lexicon) OST339953 (lexicon) OST61479 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20683
Vector Insertion
Chr 16: 17386423 - 17389433
Public Clones not available
Private Clones OST354926 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29262
Vector Insertion
Chr 16: 17381983 - 17386328
Public Clones not available
Private Clones OST1527 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI585
Vector Insertion
Chr 16: 17373510 - 17377010
Public Clones AZ0547 (sanger) RRO073 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4064
Vector Insertion
Chr 16: 17348859 - 17350854
Public Clones AP1020 (sanger) AP0919 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9723
Vector Insertion
Chr 16: 17318647 - 17323080
Public Clones XG064 (baygenomics) IST11595D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6428
Vector Insertion
Chr 16: 17283503 - 17284539
Public Clones CSA038 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036161
Sequence
CAAGGACCTGCTGGTACTGGCAGCGGTAGCCTCGGCCCTGCGCAACACCTCCTGTCTCAG - UNI19437 - GTTCAAAAGCTGCTTTGCATGTGCCC

AGTAGATTTTCATGGAATCTTCCAACTAGATGAAAGACGGAGAGATGCAGTGATTGCATTGGGCATTTTTCTCATTGAATCTGATCTTCAG - UNI206

83 - CACAAAGATTGTGTTGTTCCTTATCTTCTTCGACTTCTCAGGGGTCTTCCAAAAGTGTATTGGGTAGAAGAAAGCACAGCTCGGAAAGGCAGAG 

- UNI29262 - GTAACCTCCCAGTTGCAGAGAGCTTCAGCTTCTGCCTGGTGACCTTGCTGTCTGATGTGGCTTGCAGGGACCCCTCACTTAGGGATG

AG ATTTTAGAGGCAATTTTGCAGGTTTTACATGTCCTTTTGGGAATGTGCCAGGCCTTGGAGATTCAAGAAAAAG AATACCTTTGCAAGTATGCGATC

CCATGCCTGATAGGAATCTCAAGATCTTTTGGACGTTACAGCAATTCAGAAGAGTCTCTCCTCTCAAAGCTTTTCCCCAAAGTTTCTCCTCATTCCCTGA

GAATCCCAGAAGAGCTAGAAGGTGTCCGAAGGCGTTCCTTTAATGACTTTCGCTCCATCCTGCCCAGCAACCTGCTAACTGTCTGTCAGGAGGGCACACT

GAAGAGGAAAACCAGCAGTGTGTCCAGCATCTCTCAG - UNI585 - GTTAGCCCAGAACGTGGCATACCCCCTCCCAGCTCCCCTGGAGGATCTGCA

TTTCACTATTTTGAAG CTTCTTGCCTACCTGATGGGACTGCCTTGGAGCCTGAATACTACTTCTCTACCATCAGCTCCAGTTTTTCTATCTCTCCCCTG

TTCAATGGTATTACCTATAAGGAGTTCTGTATTCCACTGGAAATGCTTCGGGAACTCTTAAACTTG GTGAAGAAGATTGTTGAGGAGCCTGTTCTCAAA

TCCTTAGATGCAATTGTAGCCGGCGTGATGGAG GCCAATCCCAGTGCTGATCTGTACTATACAACCTTCAGTGATCCCCTGTACCTGACCATGTTCAAG

ATGCTTCGAGATACTCTGTACTACATGAAAG ATCTGCCCACTTCCTTTGTGAAAGAGATCCATGATTTTGTGTTGGAGCAGTTCAACATGAGCCAAGGG

GAGCTCCAAAAGATTCTGCATGACGCAGATAGGATCCACAGTGAGATGAGCCCACTCAAACTGCGCTGCCAAGCAAACGCTGCCTGTGTGGACCTCATGG

TGTGGGCTGTGAAGGATGAGCAGG GTGCAGAAAACCTTTGCATCAAGCTGTCTGAAAAGCTGCAGTCCAAGACATCCAGTAAGGTCATCATTGCCCATT

TGCCCTTGCTGATCTGCTGCCTACAG GGTCTGGGCCGCCTGTGTGAAAGGTTCCCAGTGGTGGTCCACTCAGTGACGCCATCTTTGAGAGACTTTCTGG

TAATTCCATCCCCAGTGCTGGTGAAGCTCTATAAGTACCACAGTCAGTACCACACAG TTGCTGGCAGTGATATAAAAATCAGTGTCACCAATGAGCATT

CCGAGTCAACTCTGAATGTCTTGCCGGGCAAGAAGAACCAGCCATCCATGTATGAGCAGCTCCGAGACATCGCCATTGACAACATCTGCAG GTGCCTGA

AGGCCGGCCTCACCGTGGACCCTGTGATCGTGGAGGCCTTCCTGGCCAGCCTCTCCAACCGGCTCTACATTTCCCAGGAGAGTGACAA GGATGCTCACT

TGATTCCTGACCATACCATCCGTGCCTTGGGACACATTGCAGTAGCTTTGAGGGACACTCCAAAGGTCATGGAGCCAATTCTGCAGATCCTGCAGCAGAA

ATTTTGCCAGCCCCCCTCACCCCTTGATGTGCTCATCATCGACCAGCTGGGCTGCCTGGTGATCACTGGAAAT CAATACATTTATCAGGAAGTGTGGAA

TCTCTTCCAGCAAATCAGTGTAAAGGCCAGTTCAGTTGTGTATTCAGCCACCAAAGACTATAAAGACCATGGCTACAG GCACTGCTCCCTAGCAGTGAT

CAATGCCCTGGCCAACATTGCAGCCAACATTCAGGAGGAGCATCTTGTGGACGAGCTGTTGATGAACCTGCTGGAACTGTTTGTGCAGCTGGGGCTGGAG

GGGAAAAGAGCCAGTGAGAGGGCCAGTGAAAAGGGGCCTGCCCTGAAG - UNI4064 - GCTTCCAGCAGTGCAGGAAATTTGGGCGTGCTCATTCCT

GTAATAGCTGTG CTCACCCGACGATTGCCACCCATCAAAGAAGCTAAACCTAGGCTACAGAAGCTTTTCCGAGATTTCTGGCTCTACTCTGTGCTAATG

GGATTCGCTGTGGAAGGCTCAG GACTCTGGCCGGAAGAGTGGTATGAGGGAGTCTGTGAAATAGCTACCAAGTCACCTCTGCTTACCTTTCCCAGCAAA

GAGCCTCTGCGATCAGTCCTCCAGTACAATTCAGCTATGAAAAACGATACGGTCACCCCT GCTGAACTGAGTGAGCTCCGAAGTACCATCATCAACTTG

CTAGATCCTCCTCCTGAGGTGTCTGCCCTCATCAACAAGCTGGACTTTGCCATGTCTACCTATCTCTTGTCTGTGTATCGGCTGGAGTACATGAG GGTA

CTGCGTTCTACAGATCCAGATCGCTTCCAGGTAATGTTCTGCTACTTTGAGGATAAAGCTATTCAAAAAGACAAATCTG - UNI9723 - GGATGATG

CAGTGTGTCATTGCTGTTGCTGACAAAGTGTTTGATGCTTTCCTGAACATGATGGCAGAAAAA GCTAAGACCAAGGAGAATGAAGAGGAGCTGGAGCGG

CATGCACAGTTTCTGCTGGTGAACTTCAACCACATTCATAAGAGGATAAGGAGAGTAGCTGACAAATACCTATCTGGTCTGGTGGATAA GTTTCCACAC

TTGCTCTGGAGCGGGACTGTGCTGAAGACCATGTTGGACATCCTGCAGACCCTGTCACTATCACTAAGTGCT GATATTCACAAGGACCAACCTTACTAT

GACATTCCTGATGCCCCCTATCGGATCACGGTTCCTGACACATACGAAGCCCGGGAG AGCATCGTGAAAGACTTTGCTGCGCGCTGTGGAATGATCCTA

CAGGAAGCCATGAAGTGGGCACCCACGGTCACTAAGTCCCACCTACAG GAATATCTGAACAAGCATCAGAACTGGGTGTCAGGACTGTCTCAGCACACA

GGATTGGCCATGGCCACTGAGAGCATCCTTCATTTTGCCGGCTACAACAAGCAGAACACAACTCTTGGG GCAACTCAGCTAACTGAGCGTCCGGCCTGT

GTGAAGAAAGACTACTCCAACTTCATGGCATCCTTGAATTTGCGCAACCGCTATGCCGGCGAG GTACATGGAATGATTCGGTTCTCAGGTGCCACAGGC

CAGATGTCTGACCTGAACAAAATGATGGTCCAAGATCTGATCACAGCTTTGGACCACAGTCATCCTCAGCACTATACACAAGCCATGTTCAAATTGACGG

CAATGCTCATTAGCAGCAAAG ATTGTGATCCACAGCTCCTTCATCATCTGTGTTGGGGTCCCCTCCGAATGTTCAATGAGCATGGCATGGAGACTGCAC

TAGCCTGCTGGGAGTGGCTGCTGGCTGGCAAGAATGGAGTGGAAGTGCCG TTTATGCGGGAGATGGCAGGAGCCTGGCACATGACAGTAGAGCAGAAGT

TCGGCCTCTTTTCTGTGGAAACAAAGGAAGCAGACCCCCTGGCAGCATCAGAAGCAAGTCAGCCAAGACCTTGTCCCCCCGAAGTGACACCTCACTACAT

CTGGATCGAT TTCCTGGTCCAGCGGTTTGAGATTGCCAAGTACTGTAGCTCTGACCAGGTGGAGATCTTCTCAAGCCTGCTGCAGCGCTCCATGTCCCT

CAATATTGGTGGAGCCAGGGGGAGCATGAACAGGCATGTGGCAGCCATTGGACCACGTTTCAA ACTGCTGACCTTGGGGCTGTCCCTCCTGCATGCTGA

TGTGGTTCCAAATGCAACCATTCGAAACGTGCTTCGAGAGAAGATATACTCAACAGCCTTTGACTATTTCAG TTGTCCACCAAAGTTTCCTACTCAAGG

AGAAAAGAGGCTTCGTGAAGATATAAGCATAATGATTAAGTTTTGGACTGCCATGTTCTCAGATAAGAAGTACCTGACTGCCAGCCAGCTCGTTCCCCCA

G ATAATCAGGACACCCGAAGCAACTTGGATATAACTGTGGGCTCTCGACAACAGGCTACCCAGGGCTGGATCAACACTTACCCCCTCTCCAGTGGCATG

TCAACCATCTCCAAAAAGTCAG GTATGTCTAAGAAAACCAACCGGGGCTCCCAGCTGCACAAGTACTACATGAAACGCAGGACACTGCTGCTGTCACTA

TTG GCCACTGAGATCGAACGCCTCATCACTTGGTACAACCCACTGTCAGCCCCAGAGCTAGAGCTGGACCAGGCAGGAGAGAACAGCGTTGCCAACTGG

AGGTCCAAGTACATCAGCTTGAGTGAGAAGCAGTGGAAGGACAACGTGAACCTTGCCTGGAGCATCTCTCCATACCTCGCTGTGCAGCTGCCAGCCAG G

TTCAAGAATACAGAAGCCATTGGAAATGAAGTGACCCGTCTCGTTCGCTTGGATCCTGGAGCTGTTAGTGATGTCCCTGAAGCCATCAAG TTCCTTGTC

ACCTGGCACACCATCGATGCTGATGCTCCAGAGCTCAGCCATGTTTTATGCTGGGCACCCACGGACCCACCTACAGGCCTCTCCTACTTCTCCAGCATGT

ACCCACCACACCCTCTCACTGCACAGTATGGGGTAAAAGTCCTGCGATCCTTCCCTCCG GATGCCATTCTGTTCTACATCCCCCAGATTGTGCAGGCCC

TCAGATATGACAAG ATGGGCTATGTGCGTGAGTACATTCTCTGGGCTGCAGCCAAATCCCAGCTTCTGGCACACCAGTTTATTTGGAACATGAAAACTA

ACATCTACCTTGATGAAGAAGGGCACCAGAAAGACC CTGACATCGGTGACCTCCTGGAGCAGTTAGTAGAAGAGATCACAGGGTCTCTATCAGGCCCAG

CCAAAGATTTCTATCAACGGGAATTTGATTTCTTTAACAAGATCACAAACGTGTCAGCCATCATCAA GCCCTACCCTAAAGGCGATGAAAGGAAGAAGG

CTTGTCTGTCAGCTCTGTCTGAAGTGAAGGTGCAGCCTG GCTGCTACCTGCCCAGCAACCCTGAAGCAATCGTGCTAGACATTGACTACAAGTCAGGGA

CACCAATGCAGAG TGCCGCAAAAGCGCCGTATCTGGCCAAGTTTAAGGTGAAGAGATGCGGAGTGAGTGAACTTGAAAAAGAAG - UNI6428 - GT

CTGCAGTGCCGCTCAGACGCAGAGGATGAATGCTTCAGCCAAGAGGCTGATGGCAAGAAGATCTGCTGGCAAGCAGCCATCTTCAAAGTGGGGGATGACT

GCCGACAG GACATGTTAGCCCTGCAGATCATCGACCTCTTCAAGAACATCTTCCAGCTGGTTGGCCTGGACCTCTTCGTTTTTCCTTATCGGGTAGTGG

CTACTGCCCCTGGG TGCGGAGTGATTGAGTGCATCCCAGACTGTACCTCCCGGGACCAGCTGGGCCGCCAGACTGACTTTGGCATGTATGACTACTTTA

CACGCCAGTATGGGGATGAGTCTACCTTGGCCTTCCAGCAG GCACGCTACAACTTTATCAGAAGCATGGCCGCCTATAGCCTCCTGCTGTTCCTGCTGC

AGATCAAGGACAGGCACAATGGCAACATCATGCTGGACAAGAAGGGGCACATCATCCACATCG ACTTTGGCTTCATGTTTGAAAGCTCACCGGGTGGCA

ACCTTGGCTGGGAACCAGACATCAAGCTGACAGACGAGATGGTGATGATTATGGGGGGCAAAATGGAAGCCACACCCTTCAAGTGGTTCATGGAGATGTG

TGTCCGAGGTTATCTGGCTGTGCG CCCCTATATGGATGCAGTCGTCTCCCTGGTTACACTCATGTTGGACACAGGCCTGCCCTGTTTTCGTGGCCAGAC

AATCAAACTTTTGAA ACACAGGTTCAGCCCGAACATGACAGAGCGGGAGGCTGCGAATTTTATCATGAAGGTCATCCAGAACTGTTTCCTCAGCAACAG

 GAGCCGGACCTACGACATGATCCAGTACTACCAGAATGATATCCCCTACTGAGAAGCCTAGCCTAGCACCTGAAGCCTTGAGTGTCACAGAGCAACTCG

TCCTGCCACCGTAGGCCTGGCTGTGGGGGCAACGGGCACATGGACCGTTGATGCACACGTGTGAGTCTCTTTCACACTGGACACATTCCGTTTGTTCACC

CGTCATACTACATTGGTACATGAAGTATTTTCTTGTATAAACATGAAAAAAATAAAAATCCCAAAATGTG
Translation
 - UNI19437 - MCPVDFHGIFQLDERRRDAVIALGIFLIESDLQ - UNI20683 - HKDCVVPYLLRLLRGLPKVYWVEESTARKGRG - UNI2

9262 - GNLPVAESFSFCLVTLLSDVACRDPSLRDE ILEAILQVLHVLLGMCQALEIQEKE EYLCKYAIPCLIGISRSFGRYSNSEESLLSKLFPKV

SPHSLRIPEELEGVRRRSFNDFRSILPSNLLTVCQEGTLKRKTSSVSSISQ - UNI585 - VSPERGIPPPSSPGGSAFHYFEA ASCLPDGTALEPE

YYFSTISSSFSISPLFNGITYKEFCIPLEMLRELLNL VKKIVEEPVLKSLDAIVAGVME ANPSADLYYTTFSDPLYLTMFKMLRDTLYYMKD DLPTS

FVKEIHDFVLEQFNMSQGELQKILHDADRIHSEMSPLKLRCQANAACVDLMVWAVKDEQG GAENLCIKLSEKLQSKTSSKVIIAHLPLLICCLQ GLGR

LCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTV VAGSDIKISVTNEHSESTLNVLPGKKNQPSMYEQLRDIAIDNICR RCLKAGLTVDPVI

VEAFLASLSNRLYISQESDK KDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQKFCQPPSPLDVLIIDQLGCLVITGN QYIYQEVWNLFQQISV

KASSVVYSATKDYKDHGYR RHCSLAVINALANIAANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALK - UNI4064 - ASSSAGNLGV

LIPVIAV LTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSG GLWPEEWYEGVCEIATKSPLLTFPSKEPLRSVLQYNSAMKNDTVTP AELSELR

STIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMR RVLRSTDPDRFQVMFCYFEDKAIQKDKSG - UNI9723 - GMMQCVIAVADKVFDAFLN

MMAEK AKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDK KFPHLLWSGTVLKTMLDILQTLSLSLSA DIHKDQPYYDIPDAPYRITVPD

TYEARE SIVKDFAARCGMILQEAMKWAPTVTKSHLQ EYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLG ATQLTERPACVKKDYSNFMAS

LNLRNRYAGE VHGMIRFSGATGQMSDLNKMMVQDLITALDHSHPQHYTQAMFKLTAMLISSKD DCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLA

GKNGVEVP FMREMAGAWHMTVEQKFGLFSVETKEADPLAASEASQPRPCPPEVTPHYIWID FLVQRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGARG

SMNRHVAAIGPRFK KLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFS SCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPD DN

QDTRSNLDITVGSRQQATQGWINTYPLSSGMSTISKKSG GMSKKTNRGSQLHKYYMKRRTLLLSLL ATEIERLITWYNPLSAPELELDQAGENSVANW

RSKYISLSEKQWKDNVNLAWSISPYLAVQLPAR RFKNTEAIGNEVTRLVRLDPGAVSDVPEAIK FLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFS

SMYPPHPLTAQYGVKVLRSFPP DAILFYIPQIVQALRYDK MGYVREYILWAAAKSQLLAHQFIWNMKTNIYLDEEGHQKDP PDIGDLLEQLVEEITG

SLSGPAKDFYQREFDFFNKITNVSAIIK KPYPKGDERKKACLSALSEVKVQPG GCYLPSNPEAIVLDIDYKSGTPMQS SAAKAPYLAKFKVKRCGVS

ELEKEG - UNI6428 - GLQCRSDAEDECFSQEADGKKICWQAAIFKVGDDCRQ DMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPG CGVIECI

PDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQ ARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHID DFGFMFESSPGGNLGWEPDIKL

TDEMVMIMGGKMEATPFKWFMEMCVRGYLAVR RPYMDAVVSLVTLMLDTGLPCFRGQTIKLLK KHRFSPNMTEREAANFIMKVIQNCFLSNR RSRTY

DMIQYYQNDIPY

For any suggestions or comments, please send an email to unitrap@crg.es