Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041740 (Rnf10)
Chromosomal location
Chr 5: 115691421 - 115722907 (-)
Description
ring finger protein 10 Gene [Source:MGI (curated);Acc:Rnf10-002]
RefSeq_dna
NM_016698 
RefSeq_peptide
NP_057907.1 
UniGene
Mm.30051 
MGI
MGI:1859162 
Uniprot/SWISSPROT
Q3UIW5 
Uniprot/SPTREMBL
Q3U0W6 
Human Ortholog
ENSG00000022840 (RNF10)
Omim not available
UniTrap UNI6067
Vector Insertion
Chr 5: 115722327 - 115722354
Public Clones YHD139 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI409
Vector Insertion
Chr 5: 115722265 - 115722902
Public Clones GC1453 (tigem) XH178 (baygenomics) CSH634 (baygenomics) CSH587 (baygenomics)
XC366 (baygenomics) CSH675 (baygenomics) BGC001 (baygenomics) CSH651 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2850
Vector Insertion
Chr 5: 115710127 - 115710159
Public Clones AD0443 (sanger) AF0552 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14584
Vector Insertion
Chr 5: 115710127 - 115722327
Public Clones D093C11 (ggtc) D060A05 (ggtc) FHCRC-GT-S8-11B1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4709
Vector Insertion
Chr 5: 115701471 - 115705358
Public Clones XT0156 (sanger)
Private Clones OST446152 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI613
Vector Insertion
Chr 5: 115697296 - 115698590
Public Clones AY0667 (sanger)
Private Clones OST454633 (lexicon) OST358655 (lexicon)
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25252
Vector Insertion
Chr 5: 115694131 - 115695857
Public Clones not available
Private Clones OST190212 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38279
Vector Insertion
Chr 5: 115692642 - 115694131
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100842
Sequence
ATGCTGTTTGGCGACTCGTCGCCATTCCCGGAGCAGCTCGGCCTCGGCCCAGAGGCGAGTGTCGGTCGCTGTGTCGGAGACCCCGGTCCCCGGCACCGAG

ACAGCCAGCCCTCTCTCCTGCCCCGCGGCGGGAGAGCGTGTCCGGCCGGCCGGCGGGGCTCGCGACCCTCCCGCGCCTCCCTTTCCCCCGCAGCCTCTGC

CCCGCCAGGCCCGGCCCGGACCTCCGAGCCCCGGCCTCCTCCTCCTCCTCCTCCTCGTCCTCGTCCTCCTCTTCGGTCACCGCCGCCTCTGGGCCCCACA

ACCCCACCTTGCCGCTTCTCCTTCCATTTTGAGAAGCTGAGGAAGGAAACAAGGAAAAATGTCGCCATGAAGGCCGAGAACCGCTGCCGCCGCCGACCCC

CGCCGGCCCTGAACGCCATGAGCCTGGGTCCCCGCCGCGCCCGCTCCGCTCCGACCGCCGTCGCCGCCGAGGCCCCCTTTGATGCCGCAGAGCTCCCCCA

GCGCCGCCGCCACCGCCTCCGACATGGACAAGAACAGCGGCTCCAACAGCTCCTCCGCCTCCTCGGGCAGCAGCAA - UNI409 - - UNI6067 - 

- UNI14584 - GGGCAACAGCCGCCCCGCTCCGCCTCGGCGGGGCCGGCCGGCGAGTCTAAACCCAAGAGTG - UNI409 - - UNI14584 - A

TGGAAAGAACTCAAATGGATCCAAGCGTTACAATCGCAAGCGTGAACCCTCCTACCCCAAAAATGAAAATTTTAGCAACCAGTCCCGTCGCTCCAATTCA

CAGAAAAGCAAAACTTTTAACAAGATGCCTCCTCAAAGGGGCGGTGGCAGCAGCAAACCCTTTAGCTCTTCTTCTAATGGTGGAAGACGAGATGAG - U

NI2850 - - UNI14584 - GTAGCAGAGGCTCAGCGGGCAGAGTTTAGCCCTGCCCAGTTCTCTGGCCCTAAGAAGATCAACCTGAACCACTTGTTA

AATTTCACCTTTGAACCACGTGGCCAGGCAGGTCACTTTGAAGGCAGTGGGCATGGCGGCTGGGGGAAGAGAAACAAGTGGGGACACAAGCCTTTCAACA

AGGAGCTCTTTCTACAGGCCAA CTGCCAATTTGTGGTGTCTGAAGACCAAGACTACGCAGCTCACTTTGCTGACCCTGACACCTTAGTCAACTGGGACT

TTGTGGAACAAGTG - UNI4709 - CGCATCTGTAGCCATGAAGTGCCATCTTGCCCAATATGCCTCTATCCACCTACTGCGGCCAAGATAACGCGCT

GTGGACACATTTTCTGCTGGGCATGCATCCTGCACTATCTTTCACTCAGTGAGAAAACCTGGAGCAAATGTCCCATCTGCTACAGCTCTGTGCATAAGAA

GGATCTCAAGAG TGTTGTTGCCACAGAGTCTCGACAGTATGCTGTGGGGGACACCATTACCATGCAGCTGATGAAGAGAGAGAAGGGAGTGTTGGTGGC

CCTGCCCAAATCCAAGTGGGTGAATGTAGACCATCCTATTAACCTAGGAG ATGAGCAGCTCAGCCAGTATTCCAAGCTGCTGCTGGCCTCGAAGGAGCA

GGTGCTGCACCGGGTAGTTCTGGAGGAGAAAGGAGCGCTGGAGCAGCAGCTGGCAGAGGAGAAGCACACTCCTGAGTCCTGTTTCATTGAGGCTGCTATC

CAGGAGGTCAAG ATTCGGGAAGAAGCTCTGTCAGGAGTGGCTGGAGGCGGAGGGGAGGTCACTGGTGTTGTGGCTGCTCTGGAACACCTGGTGCTGATG

GCTCCCCTGGCCACGGAGTCTGCTTTCCAACCCAGGAAG CAGGGTGTGCTGGAGTATCTGTCTGCTTTTGATGATGAAGCTGCACAAGTTTGTTCTCTG

GACCCCCCTGGTCCTCTTGCCCTCCCTTTGGTAGAAGAGGAGGAAGCAGTGTCTGAGCCAGAAGCCTGTGAGGACGCAGAGGTAGCCGATGACAGTCTGG

GAGAGGGGACTGTTGGTCCTGAGATGAGCCAGGAGGAGCCCATCACTAAGCCAGGCTTCACCCAGCTCAGCAGCTCTCCGTGTTACTACTTCTACCAGG 

CGGAAGATGGACAGCACATGTTCCTGCACCCTGTCAACGTGCGCTGCCTTGTGCGGGAGTACGGCAGCCTGGAGCAGAGCCCAGAGAAGATCTCAGCAAC

CGTGGTAGAGATTGCTGGGTATTCCATGTCTGAG - UNI613 - GATGTTCGGCAGCGTCATAGGTATCTCTCTCACTTGCCACTCACCTGTGAGTTC

AGCATCTGTGAACTGGCTCTGCAGCCTCCTGTGGTCTCTAAGGAAACCCTAGAGATGTTCTCAG ATGACATTGAGAAAAGGAAGCGTCAGCGCCAAAAG

AAGGCTCGCGAGGAGCGTCGCCGAGAGCGCAGAATTGAGATGGAGGAGAACAAGAGACAGGGCAGGT ATCCCGAGGTCCACATTCCCCTCGAGAACCTA

CAGCAGTTTCCGGCCTTCAATTCCTATACCTGTCCCTCTGATTCTGCTTTGGGTCCCACCAGCACTGAGGGCCATGGGGCCCTATCCCTGTCTCCTCTGA

GCAGAAGTCCAGGCTCCCATGCAG - UNI25252 - ACTTTCTGCTGACCCCTCTGTCACCCACTGCCAGTCAGGGCAGTCCTTCCTTCTGCGTTGGG

AGTCTGGAAGACGACTCTCCCTTCCTTTCCTTTGCCCAG ATGCTGAGGGTTGGCAAAGCAAAAGCAGACGGGTGGCCCAAAACTGCTCCAAAGAAAG A

TGACAATAGCTTGGTTCCTCCCGCCCCTGTGGACAGTGATGGGGAGAGTGACAATTCTGACCGTGTTCCTGTGCCCAGTTTCCAAAATTCCTTCAGCCAA

GCTATCGAAGCAGCCTTCATGAAATTGGACACACCAGCTACTTCAGACCCCCTCTCTG AAGACAGAGGAGGGAAGAAAAGGAAGAGACAGAAGCAGAAG

CTGCTGTTCAGCACCTCGGTCGTCCACACCAAGTGACACTATTGCCCAGGCGCCTTCTCCATCGGGTTTCCTCTCTGTGCTTTTGTTTTGCTGCTGTAAT

TTTTAAGTATTTGAGTTTGAACAGATTGATTAGCTTGGGGCGGGGGGAGGGGCTTTCCACAAAGTGAGGGGGAACCAAGAAAATTTTAAATACAGTGTAT

TTTCCAGCTTCCCCTCTTTACACCAGAATAAAGTATTGACACTC
Translation
MLFGDSSPFPEQLGLGPEASVGRCVGDPGPRHRDSQPSLLPRGGRACPAGRRGSRPSRASLSPAASAPPGPARTSEPRPPPPPPPRPRPPLRSPPPLGPT

TPPCRFSFHFEKLRKETRKNVAMKAENRCRRRPPPALNAMSLGPRRARSAPTAVAAEAPFDAAELPQRRRHRLRHGQEQRLQQLLRLLGQQQ - UNI40

9 - - UNI6067 - - UNI14584 - GQQPPRSASAGPAGESKPKSD - UNI409 - - UNI14584 - DGKNSNGSKRYNRKREPSYPKNENF

SNQSRRSNSQKSKTFNKMPPQRGGGSSKPFSSSSNGGRRDE - UNI2850 - - UNI14584 - VAEAQRAEFSPAQFSGPKKINLNHLLNFTFEPR

GQAGHFEGSGHGGWGKRNKWGHKPFNKELFLQAN NCQFVVSEDQDYAAHFADPDTLVNWDFVEQV - UNI4709 - RICSHEVPSCPICLYPPTAAK

ITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKS SVVATESRQYAVGDTITMQLMKREKGVLVALPKSKWVNVDHPINLGD DEQLSQYSKL

LLASKEQVLHRVVLEEKGALEQQLAEEKHTPESCFIEAAIQEVK IREEALSGVAGGGGEVTGVVAALEHLVLMAPLATESAFQPRK QGVLEYLSAFDD

EAAQVCSLDPPGPLALPLVEEEEAVSEPEACEDAEVADDSLGEGTVGPEMSQEEPITKPGFTQLSSSPCYYFYQA AEDGQHMFLHPVNVRCLVREYGSL

EQSPEKISATVVEIAGYSMSE - UNI613 - DVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSD DDIEKRKRQRQKKAREERRRERRIEM

EENKRQGRY YPEVHIPLENLQQFPAFNSYTCPSDSALGPTSTEGHGALSLSPLSRSPGSHAD - UNI25252 - DFLLTPLSPTASQGSPSFCVGSL

EDDSPFLSFAQ MLRVGKAKADGWPKTAPKKD DDNSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSE EDRGGKKRKRQK

QKLLFSTSVVHTK
Transcript ENSMUST00000040555
Sequence
GCTGTTTGGCGACTCGTCGCCATTCCCGGAGCAGCTCGGCCTCGGCCCAGAGGCGAGTGTCGGTCGCTGTGTCGGAGACCCCGGTCCCCGGCACCGAGAC

AGCCAGCCCTCTCTCCTGCCCCGCGGCGGGAGAGCGTGTCCGGCCGGCCGGCGGGGCTCGCGACCCTCCCGCGCCTCCCTTTCCCCCGCAGCCTCTGCCC

CGCCAGGCCCGGCCCGGACCTCCGAGCCCCGGCCTCCTCCTCCTCCTCCTCCTCGTCCTCGTCCTCCTCTTCGGTCACCGCCGCCTCTGGGCCCCACAAC

CCCACCTTGCCGCTTCTCCTTCCATTTTGAGAAGCTGAGGAAGGAAACAAGGAAAAATGTCGCCATGAAGGCCGAGAACCGCTGCCGCCGCCGACCCCCG

CCGGCCCTGAACGCCATGAGCCTGGGTCCCCGCCGCGCCCGCTCCGCTCCGACCGCCGTCGCCGCCGAGGCCCCCTTTGATGCCGCAGAGCTCCCCCAGC

GCCGCCGCCACCGCCTCCGACATGGACAAGAACAGCGGCTCCAACAGCTCCTCCGCCTCCTCGGGCAGCAGCAAAGGGCAACAGCCGCCCCGCTCCGCCT

CGGCGGGGCCGGCCGGCGAGTCTAAACCCAAGAGTG - UNI409 - - UNI14584 - ATGGAAAGAACTCAAATGGATCCAAGCGTTACAATCGCA

AGCGTGAACCCTCCTACCCCAAAAATGAAAATTTTAGCAACCAGTCCCGTCGCTCCAATTCACAGAAAAGCAAAACTTTTAACAAGATGCCTCCTCAAAG

GGGCGGTGGCAGCAGCAAACCCTTTAGCTCTTCTTCTAATGGTGGAAGACGAGATGAG - UNI2850 - - UNI14584 - GTAGCAGAGGCTCAGC

GGGCAGAGTTTAGCCCTGCCCAGTTCTCTGGCCCTAAGAAGATCAACCTGAACCACTTGTTAAATTTCACCTTTGAACCACGTGGCCAGGCAGGTCACTT

TGAAGGCAGTGGGCATGGCGGCTGGGGGAAGAGAAACAAGTGGGGACACAAGCCTTTCAACAAGGAGCTCTTTCTACAGGCCAA CTGCCAATTTGTGGT

GTCTGAAGACCAAGACTACGCAGCTCACTTTGCTGACCCTGACACCTTAGTCAACTGGGACTTTGTGGAACAAGTG - UNI4709 - CGCATCTGTAG

CCATGAAGTGCCATCTTGCCCAATATGCCTCTATCCACCTACTGCGGCCAAGATAACGCGCTGTGGACACATTTTCTGCTGGGCATGCATCCTGCACTAT

CTTTCACTCAGTGAGAAAACCTGGAGCAAATGTCCCATCTGCTACAGCTCTGTGCATAAGAAGGATCTCAAGAG TGTTGTTGCCACAGAGTCTCGACAG

TATGCTGTGGGGGACACCATTACCATGCAGCTGATGAAGAGAGAGAAGGGAGTGTTGGTGGCCCTGCCCAAATCCAAGTGGGTGAATGTAGACCATCCTA

TTAACCTAGGAG ATGAGCAGCTCAGCCAGTATTCCAAGCTGCTGCTGGCCTCGAAGGAGCAGGTGCTGCACCGGGTAGTTCTGGAGGAGAAAGGAGCGC

TGGAGCAGCAGCTGGCAGAGGAGAAGCACACTCCTGAGTCCTGTTTCATTGAGGCTGCTATCCAGGAGGTCAAG ATTCGGGAAGAAGCTCTGTCAGGAG

TGGCTGGAGGCGGAGGGGAGGTCACTGGTGTTGTGGCTGCTCTGGAACACCTGGTGCTGATGGCTCCCCTGGCCACGGAGTCTGCTTTCCAACCCAGGAA

G GGTGTGCTGGAGTATCTGTCTGCTTTTGATGATGAAGCTGCACAAGTTTGTTCTCTGGACCCCCCTGGTCCTCTTGCCCTCCCTTTGGTAGAAGAGGA

GGAAGCAGTGTCTGAGCCAGAAGCCTGTGAGGACGCAGAGGTAGCCGATGACAGTCTGGGAGAGGGGACTGTTGGTCCTGAGATGAGCCAGGAGGAGCCC

ATCACTAAGCCAGGCTTCACCCAGCTCAGCAGCTCTCCGTGTTACTACTTCTACCAGG CGGAAGATGGACAGCACATGTTCCTGCACCCTGTCAACGTG

CGCTGCCTTGTGCGGGAGTACGGCAGCCTGGAGCAGAGCCCAGAGAAGATCTCAGCAACCGTGGTAGAGATTGCTGGGTATTCCATGTCTGAG - UNI6

13 - GATGTTCGGCAGCGTCATAGGTATCTCTCTCACTTGCCACTCACCTGTGAGTTCAGCATCTGTGAACTGGCTCTGCAGCCTCCTGTGGTCTCTAA

GGAAACCCTAGAGATGTTCTCAG ATGACATTGAGAAAAGGAAGCGTCAGCGCCAAAAGAAGGCTCGCGAGGAGCGTCGCCGAGAGCGCAGAATTGAGAT

GGAGGAGAACAAGAGACAGGGCAGGT ATCCCGAGGTCCACATTCCCCTCGAGAACCTACAGCAGTTTCCGGCCTTCAATTCCTATACCTGTCCCTCTGA

TTCTGCTTTGGGTCCCACCAGCACTGAGGGCCATGGGGCCCTATCCCTGTCTCCTCTGAGCAGAAGTCCAGGCTCCCATGCAG - UNI25252 - ACT

TTCTGCTGACCCCTCTGTCACCCACTGCCAGTCAGGGCAGTCCTTCCTTCTGCGTTGGGAGTCTGGAAGACGACTCTCCCTTCCTTTCCTTTGCCCAG A

TGCTGAGGGTTGGCAAAGCAAAAGCAGACGGGTGGCCCAAAACTGCTCCAAAGAAAG ATGACAATAGCTTGGTTCCTCCCGCCCCTGTGGACAGTGATG

GGGAGAGTGACAATTCTGACCGTGTTCCTGTGCCCAGTTTCCAAAATTCCTTCAGCCAAGCTATCGAAGCAGCCTTCATGAAATTGGACACACCAGCTAC

TTCAGACCCCCTCTCTG AAGACAGAGGAGGGAAGAAAAGGAAGAGACAGAAGCAGAAGCTGCTGTTCAGCACCTCGGTCGTCCACACCAAGTGACACTA

TTGCCCAGGCGCCTTCTCCATCGGGTTTCCTCTCTGTGCTTTTGTTTTGCTGCTGTAATTTTTAAGTATTTGAGTTTGAACAGATTGATTAGCTTGGGGC

GGGGGGAGGGGCTTTCCACAAAGTGAGGGGGAACCAAGAAAATTTTAAATACAGTGTATTTTCCAGCTTCCCCTCTTTACACCAGAATAAAGTATTGACA

CTC
Translation
MPQSSPSAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSD - UNI409 - - UNI14584 - DGKNSNGSKRYNRKREPSYPKN

ENFSNQSRRSNSQKSKTFNKMPPQRGGGSSKPFSSSSNGGRRDE - UNI2850 - - UNI14584 - VAEAQRAEFSPAQFSGPKKINLNHLLNFTF

EPRGQAGHFEGSGHGGWGKRNKWGHKPFNKELFLQAN NCQFVVSEDQDYAAHFADPDTLVNWDFVEQV - UNI4709 - RICSHEVPSCPICLYPPT

AAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKS SVVATESRQYAVGDTITMQLMKREKGVLVALPKSKWVNVDHPINLGD DEQLSQY

SKLLLASKEQVLHRVVLEEKGALEQQLAEEKHTPESCFIEAAIQEVK IREEALSGVAGGGGEVTGVVAALEHLVLMAPLATESAFQPRK GVLEYLSAF

DDEAAQVCSLDPPGPLALPLVEEEEAVSEPEACEDAEVADDSLGEGTVGPEMSQEEPITKPGFTQLSSSPCYYFYQA AEDGQHMFLHPVNVRCLVREYG

SLEQSPEKISATVVEIAGYSMSE - UNI613 - DVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSD DDIEKRKRQRQKKAREERRRERRI

EMEENKRQGRY YPEVHIPLENLQQFPAFNSYTCPSDSALGPTSTEGHGALSLSPLSRSPGSHAD - UNI25252 - DFLLTPLSPTASQGSPSFCVG

SLEDDSPFLSFAQ MLRVGKAKADGWPKTAPKKD DDNSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSE EDRGGKKRKR

QKQKLLFSTSVVHTK
Transcript ENSMUST00000112097
Sequence
GGAGATGCTGTTTGGCGACTCGTCGCCATTCCCGGAGCAGCTCGGCCTCGGCCCAGAGGCGAGTGTCGGTCGCTGTGTCGGAGACCCCGGTCCCCGGCAC

CGAGACAGCCAGCCCTCTCTCCTGCCCCGCGGCGGGAGAGCGTGTCCGGCCGGCCGGCGGGGCTCGCGACCCTCCCGCGCCTCCCTTTCCCCCGCAGCCT

CTGCCCCGCCAGGCCCGGCCCGGACCTCCGAGCCCCGGCCTCCTCCTCCTCCTCCTCCTCGTCCTCGTCCTCCTCTTCGGTCACCGCCGCCTCTGGGCCC

CACAACCCCACCTTGCCGCTTCTCCTTCCATTTTGAGAAGCTGAGGAAGGAAACAAGGAAAAATGTCGCCATGAAGGCCGAGAACCGCTGCCGCCGCCGA

CCCCCGCCGGCCCTGAACGCCATGAGCCTGGGTCCCCGCCGCGCCCGCTCCGCTCCGACCGCCGTCGCCGCCGAGGCCCCCTTTGATGCCGCAGAGCTCC

CCCAGCGCCGCCGCCACCGCCTCCGACATGGACAAGAACAGCGGCTCCAACAGCTCCTCCGCCTCCTCGGGCAGCAGCAAAGGGCAACAGCCGCCCCGCT

CCGCCTCGGCGGGGCCGGCCGGCGAGTCTAAACCCAAGAGTG - UNI409 - - UNI14584 - ATGGAAAGAACTCAAATGGATCCAAGCGTTACA

ATCGCAAGCGTGAACCCTCCTACCCCAAAAATGAAAATTTTAGCAACCAGTCCCGTCGCTCCAATTCACAGAAAAGCAAAACTTTTAACAAGATGCCTCC

TCAAAGGGGCGGTGGCAGCAGCAAACCCTTTAGCTCTTCTTCTAATGGTGGAAGACGAGATGAG - UNI2850 - - UNI14584 - GTAGCAGAGG

CTCAGCGGGCAGAGTTTAGCCCTGCCCAGTTCTCTGGCCCTAAGAAGATCAACCTGAACCACTTGTTAAATTTCACCTTTGAACCACGTGGCCAGGCAGG

TCACTTTGAAGGCAGTGGGCATGGCGGCTGGGGGAAGAGAAACAAGTGGGGACACAAGCCTTTCAACAAGGAGCTCTTTCTACAGGCCAA CTGCCAATT

TGTGGTGTCTGAAGACCAAGACTACGCAGCTCACTTTGCTGACCCTGACACCTTAGTCAACTGGGACTTTGTGGAACAAGTG - UNI4709 - CGCAT

CTGTAGCCATGAAGTGCCATCTTGCCCAATATGCCTCTATCCACCTACTGCGGCCAAGATAACGCGCTGTGGACACATTTTCTGCTGGGCATGCATCCTG

CACTATCTTTCACTCAGTGAGAAAACCTGGAGCAAATGTCCCATCTGCTACAGCTCTGTGCATAAGAAGGATCTCAAGAG TGTTGTTGCCACAGAGTCT

CGACAGTATGCTGTGGGGGACACCATTACCATGCAGCTGATGAAGAGAGAGAAGGGAGTGTTGGTGGCCCTGCCCAAATCCAAGTGGGTGAATGTAGACC

ATCCTATTAACCTAGGAG ATGAGCAGCTCAGCCAGTATTCCAAGCTGCTGCTGGCCTCGAAGGAGCAGGTGCTGCACCGGGTAGTTCTGGAGGAGAAAG

GAGCGCTGGAGCAGCAGCTGGCAGAGGAGAAGCACACTCCTGAGTCCTGTTTCATTGAGGCTGCTATCCAGGAGGTCAAG ATTCGGGAAGAAGCTCTGT

CAGGAGTGGCTGGAGGCGGAGGGGAGGTCACTGGTGTTGTGGCTGCTCTGGAACACCTGGTGCTGATGGCTCCCCTGGCCACGGAGTCTGCTTTCCAACC

CAGGAAG CAGGGTGTGCTGGAGTATCTGTCTGCTTTTGATGATGAAGCTGCACAAGTTTGTTCTCTGGACCCCCCTGGTCCTCTTGCCCTCCCTTTGGT

AGAAGAGGAGGAAGCAGTGTCTGAGCCAGAAGCCTGTGAGGACGCAGAGGTAGCCGATGACAGTCTGGGAGAGGGGACTGTTGGTCCTGAGATGAGCCAG

GAGGAGCCCATCACTAAGCCAGGCTTCACCCAGCTCAGCAGCTCTCCGTGTTACTACTTCTACCAGG CGGAAGATGGACAGCACATGTTCCTGCACCCT

GTCAACGTGCGCTGCCTTGTGCGGGAGTACGGCAGCCTGGAGCAGAGCCCAGAGAAGATCTCAGCAACCGTGGTAGAGATTGCTGGGTATTCCATGTCTG

AG - UNI613 - GATGTTCGGCAGCGTCATAGGTATCTCTCTCACTTGCCACTCACCTGTGAGTTCAGCATCTGTGAACTGGCTCTGCAGCCTCCTGT

GGTCTCTAAGGAAACCCTAGAGATGTTCTCAG ATGACATTGAGAAAAGGAAGCGTCAGCGCCAAAAGAAGGCTCGCGAGGAGCGTCGCCGAGAGCGCAG

AATTGAGATGGAGGAGAACAAGAGACAGGGCAGGT ATCCCGAGGTCCACATTCCCCTCGAGAACCTACAGCAGTTTCCGGCCTTCAATTCCTATACCTG

TCCCTCTGATTCTGCTTTGGGTCCCACCAGCACTGAGGGCCATGGGGCCCTATCCCTGTCTCCTCTGAGCAGAAGTCCAGGCTCCCATGCAG - UNI25

252 - ACTTTCTGCTGACCCCTCTGTCACCCACTGCCAGTCAGGGCAGTCCTTCCTTCTGCGTTGGGAGTCTGGAAGACGACTCTCCCTTCCTTTCCTT

TGCCCAG ATGCTGAGGGTTGGCAAAGCAAAAGCAGACGGGTGGCCCAAAACTGCTCCAAAGAAAG ATGACAATAGCTTGGTTCCTCCCGCCCCTGTGG

ACAGTGATGGGGAGAGTGACAATTCTGACCGTGTTCCTGTGCCCAGTTTCCAAAATTCCTTCAGCCAAGCTATCGAAGCAGCCTTCATGAAATTGGACAC

ACCAGCTACTTCAGACCCCCTCTCTG AAGACAGAGGAGGGAAGAAAAGGAAGAGACAGAAGCAGAAGCTGCTGTTCAGCACCTCGGTCGTCCACACCAA

GTGACACTATTGCCCAGGCGCCTTCTCCATCGGGTTTCCTCTCTGTGCTTTTGTTTTGCTGCTGTAATTTTTAAGTATTTGAGTTTGAACAGATTGATTA

GCTTGGGGCGGGGGGAGGGGCTTTCCACAAAGTGAGGGGGAACCAAGAAAATTTTAAATACAGTGTATTTTCCAGCTTCCCCTCTTTACACCAGAATAAA

GTATTGACACTCAACTTGAGCCGCCTTCCCGACAAGCATATTCATTTGTAGCCCTTAAGTTCCTTCATCCAGTGGGACAGCACTGCTCTGCTGCAGGTTT

TTCTCCTGGGAAGAGGCTGTGCCTGTTGATTCCCCTTCTTACCAAGAGAGGTTTGGCCCTTTCACAGCCCCTTTTTCTTAAAGGCCTCCGAAAGGGTGTT

TGCATGCCTGTCTGTTGGCCCCTGCAACTGGAGTCACTCTACATTTGATTGTGAGCCTCCGTGTAGGAGCTGGAAGCTGAGCCCAACTTGTTTAAGTGCC

CGTTGTTTAAAGGCGACAGAGTCAGTTGTAAACCATCTGACAGGCAGGAGGCAGAGAGAGCTACCCGGGACACTTTC
Translation
MPQSSPSAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSD - UNI409 - - UNI14584 - DGKNSNGSKRYNRKREPSYPKN

ENFSNQSRRSNSQKSKTFNKMPPQRGGGSSKPFSSSSNGGRRDE - UNI2850 - - UNI14584 - VAEAQRAEFSPAQFSGPKKINLNHLLNFTF

EPRGQAGHFEGSGHGGWGKRNKWGHKPFNKELFLQAN NCQFVVSEDQDYAAHFADPDTLVNWDFVEQV - UNI4709 - RICSHEVPSCPICLYPPT

AAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKS SVVATESRQYAVGDTITMQLMKREKGVLVALPKSKWVNVDHPINLGD DEQLSQY

SKLLLASKEQVLHRVVLEEKGALEQQLAEEKHTPESCFIEAAIQEVK IREEALSGVAGGGGEVTGVVAALEHLVLMAPLATESAFQPRK QGVLEYLSA

FDDEAAQVCSLDPPGPLALPLVEEEEAVSEPEACEDAEVADDSLGEGTVGPEMSQEEPITKPGFTQLSSSPCYYFYQA AEDGQHMFLHPVNVRCLVREY

GSLEQSPEKISATVVEIAGYSMSE - UNI613 - DVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSD DDIEKRKRQRQKKAREERRRERR

IEMEENKRQGRY YPEVHIPLENLQQFPAFNSYTCPSDSALGPTSTEGHGALSLSPLSRSPGSHAD - UNI25252 - DFLLTPLSPTASQGSPSFCV

GSLEDDSPFLSFAQ MLRVGKAKADGWPKTAPKKD DDNSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSE EDRGGKKRK

RQKQKLLFSTSVVHTK
Transcript ENSMUST00000112096
Sequence
GCTGTTTGGCGACTCGTCGCCATTCCCGGAGCAGCTCGGCCTCGGCCCAGAGGCGAGTGTCGGTCGCTGTGTCGGAGACCCCGGTCCCCGGCACCGAGAC

AGCCAGCCCTCTCTCCTGCCCCGCGGCGGGAGAGCGTGTCCGGCCGGCCGGCGGGGCTCGCGACCCTCCCGCGCCTCCCTTTCCCCCGCAGCCTCTGCCC

CGCCAGGCCCGGCCCGGACCTCCGAGCCCCGGCCTCCTCCTCCTCCTCCTCCTCGTCCTCGTCCTCCTCTTCGGTCACCGCCGCCTCTGGGCCCCACAAC

CCCACCTTGCCGCTTCTCCTTCCATTTTGAGAAGCTGAGGAAGGAAACAAGGAAAAATGTCGCCATGAAGGCCGAGAACCGCTGCCGCCGCCGACCCCCG

CCGGCCCTGAACGCCATGAGCCTGGGTCCCCGCCGCGCCCGCTCCGCTCCGACCGCCGTCGCCGCCGAGGCCCCCTTTGATGCCGCAGAGCTCCCCCAGC

GCCGCCGCCACCGCCTCCGACATGGACAAGAACAGCGGCTCCAACAGCTCCTCCGCCTCCTCGGGCAGCAGCAAAGGGCAACAGCCGCCCCGCTCCGCCT

CGGCGGGGCCGGCCGGCGAGTCTAAACCCAAGAGTG - UNI409 - - UNI14584 - ATGGAAAGAACTCAAATGGATCCAAGCGTTACAATCGCA

AGCGTGAACCCTCCTACCCCAAAAATGAAAATTTTAGCAACCAGTCCCGTCGCTCCAATTCACAGAAAAGCAAAACTTTTAACAAGATGCCTCCTCAAAG

GGGCGGTGGCAGCAGCAAACCCTTTAGCTCTTCTTCTAATGGTGGAAGACGAGATGAG - UNI2850 - - UNI14584 - GTAGCAGAGGCTCAGC

GGGCAGAGTTTAGCCCTGCCCAGTTCTCTGGCCCTAAGAAGATCAACCTGAACCACTTGTTAAATTTCACCTTTGAACCACGTGGCCAGGCAGGTCACTT

TGAAGGCAGTGGGCATGGCGGCTGGGGGAAGAGAAACAAGTGGGGACACAAGCCTTTCAACAAGGAGCTCTTTCTACAGGCCAA CTGCCAATTTGTGGT

GTCTGAAGACCAAGACTACGCAGCTCACTTTGCTGACCCTGACACCTTAGTCAACTGGGACTTTGTGGAACAAGTG - UNI4709 - CGCATCTGTAG

CCATGAAGTGCCATCTTGCCCAATATGCCTCTATCCACCTACTGCGGCCAAGATAACGCGCTGTGGACACATTTTCTGCTGGGCATGCATCCTGCACTAT

CTTTCACTCAGTGAGAAAACCTGGAGCAAATGTCCCATCTGCTACAGCTCTGTGCATAAGAAGGATCTCAAGAG TGTTGTTGCCACAGAGTCTCGACAG

TATGCTGTGGGGGACACCATTACCATGCAGCTGATGAAGAGAGAGAAGGGAGTGTTGGTGGCCCTGCCCAAATCCAAGTGGGTGAATGTAGACCATCCTA

TTAACCTAGGAG ATGAGCAGCTCAGCCAGTATTCCAAGCTGCTGCTGGCCTCGAAGGAGCAGGTGCTGCACCGGGTAGTTCTGGAGGAGAAAGGAGCGC

TGGAGCAGCAGCTGGCAGAGGAGAAGCACACTCCTGAGTCCTGTTTCATTGAGGCTGCTATCCAGGAGGTCAAG ATTCGGGAAGAAGCTCTGTCAGGAG

TGGCTGGAGGCGGAGGGGAGGTCACTGGTGTTGTGGCTGCTCTGGAACACCTGGTGCTGATGGCTCCCCTGGCCACGGAGTCTGCTTTCCAACCCAGGAA

G GGTGTGCTGGAGTATCTGTCTGCTTTTGATGATGAAGCTGCACAAGTTTGTTCTCTGGACCCCCCTGGTCCTCTTGCCCTCCCTTTGGTAGAAGAGGA

GGAAGCAGTGTCTGAGCCAGAAGCCTGTGAGGACGCAGAGGTAGCCGATGACAGTCTGGGAGAGGGGACTGTTGGTCCTGAGATGAGCCAGGAGGAGCCC

ATCACTAAGCCAGGCTTCACCCAGCTCAGCAGCTCTCCGTGTTACTACTTCTACCAGG CGGAAGATGGACAGCACATGTTCCTGCACCCTGTCAACGTG

CGCTGCCTTGTGCGGGAGTACGGCAGCCTGGAGCAGAGCCCAGAGAAGATCTCAGCAACCGTGGTAGAGATTGCTGGGTATTCCATGTCTGAG - UNI6

13 - GATGTTCGGCAGCGTCATAGGTATCTCTCTCACTTGCCACTCACCTGTGAGTTCAGCATCTGTGAACTGGCTCTGCAGCCTCCTGTGGTCTCTAA

GGAAACCCTAGAGATGTTCTCAG ATGACATTGAGAAAAGGAAGCGTCAGCGCCAAAAGAAGGCTCGCGAGGAGCGTCGCCGAGAGCGCAGAATTGAGAT

GGAGGAGAACAAGAGACAGGGCAGGT ATCCCGAGGTCCACATTCCCCTCGAGAACCTACAGCAGTTTCCGGCCTTCAATTCCTATACCTGTCCCTCTGA

TTCTGCTTTGGGTCCCACCAGCACTGAGGGCCATGGGGCCCTATCCCTGTCTCCTCTGAGCAGAAGTCCAGGCTCCCATGCAG - UNI25252 - ACT

TTCTGCTGACCCCTCTGTCACCCACTGCCAGTCAGGGCAGTCCTTCCTTCTGCGTTGGGAGTCTGGAAGACGACTCTCCCTTCCTTTCCTTTGCCCAG A

TGCTGAGGGTTGGCAAAGCAAAAGCAGACGGGTGGCCCAAAACTGCTCCAAAGAAAG ATGACAATAGCTTGGTTCCTCCCGCCCCTGTGGACAGTGATG

GGGAGAGTGACAATTCTGACCGTGTTCCTGTGCCCAGTTTCCAAAATTCCTTCAGCCAAGCTATCGAAGCAGCCTTCATGAAATTGGACACACCAGCTAC

TTCAGACCCCCTCTCTG ACAGAGGAGGGAAGAAAAGGAAGAGACAGAAGCAGAAGCTGCTGTTCAGCACCTCGGTCGTCCACACCAAGTGACACTATTG

CCCAGGCGCCTTCTCCATCGGGTTTCCTCTCTGTGCTTTTGTTTTGCTGCTGTAATTTTTAAGTATTTGAGTTTGAACAGATTGATTAGCTTGGGGCGGG

GGGAGGGGCTTTCCACAAAGTGAGGGGGAACCAAGAAAATTTTAAATACAGTGTATTTTCCAGCTTCCCCTCTTTACACCAGAATAAAGTATTGACACTC

AACTTGA
Translation
MPQSSPSAAATASDMDKNSGSNSSSASSGSSKGQQPPRSASAGPAGESKPKSD - UNI409 - - UNI14584 - DGKNSNGSKRYNRKREPSYPKN

ENFSNQSRRSNSQKSKTFNKMPPQRGGGSSKPFSSSSNGGRRDE - UNI2850 - - UNI14584 - VAEAQRAEFSPAQFSGPKKINLNHLLNFTF

EPRGQAGHFEGSGHGGWGKRNKWGHKPFNKELFLQAN NCQFVVSEDQDYAAHFADPDTLVNWDFVEQV - UNI4709 - RICSHEVPSCPICLYPPT

AAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKS SVVATESRQYAVGDTITMQLMKREKGVLVALPKSKWVNVDHPINLGD DEQLSQY

SKLLLASKEQVLHRVVLEEKGALEQQLAEEKHTPESCFIEAAIQEVK IREEALSGVAGGGGEVTGVVAALEHLVLMAPLATESAFQPRK GVLEYLSAF

DDEAAQVCSLDPPGPLALPLVEEEEAVSEPEACEDAEVADDSLGEGTVGPEMSQEEPITKPGFTQLSSSPCYYFYQA AEDGQHMFLHPVNVRCLVREYG

SLEQSPEKISATVVEIAGYSMSE - UNI613 - DVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSD DDIEKRKRQRQKKAREERRRERRI

EMEENKRQGRY YPEVHIPLENLQQFPAFNSYTCPSDSALGPTSTEGHGALSLSPLSRSPGSHAD - UNI25252 - DFLLTPLSPTASQGSPSFCVG

SLEDDSPFLSFAQ MLRVGKAKADGWPKTAPKKD DDNSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAFMKLDTPATSDPLSD DRGGKKRKRQ

KQKLLFSTSVVHTK
Transcript ENSMUST00000112093
Sequence
ATGGACAAGAACAGCGGCTCCAACAG - UNI409 - - UNI2850 - - UNI6067 - - UNI14584 - CTCTTCTTCTAATGGTGGAAGACGA

GATGAG - UNI2850 - - UNI14584 - GTAGCAGAGGCTCAGCGGGCAGAGTTTAGCCCTGCCCAGTTCTCTGGCCCTAAGAAGATCAACCTGAA

CCACTTGTTAAATTTCACCTTTGAACCACGTGGCCAGGCAGGTCACTTTGAAGGCAGTGGGCATGGCGGCTGGGGGAAGAGAAACAAGTGGGGACACAAG

CCTTTCAACAAGGAGCTCTTTCTACAGGCCAA CTGCCAATTTGTGGTGTCTGAAGACCAAGACTACGCAGCTCACTTTGCTGACCCTGACACCTTAGTC

AACTGGGACTTTGTGGAACAAGTG - UNI4709 - CGCATCTGTAGCCATGAAGTGCCATCTTGCCCAATATGCCTCTATCCACCTACTGCGGCCAAG

ATAACGCGCTGTGGACACATTTTCTGCTGGGCATGCATCCTGCACTATCTTTCACTCAGTGAGAAAACCTGGAGCAAATGTCCCATCTGCTACAGCTCTG

TGCATAAGAAGGATCTCAAGAG TGTTGTTGCCACAGAGTCTCGACAGTATGCTGTGGGGGACACCATTACCATGCAGCTGATGAAGAGAGAGAAGGGAG

TGTTGGTGGCCCTGCCCAAATCCAAGTGGGTGAATGTAGACCATCCTATTAACCTAGGAG ATGAGCAGCTCAGCCAGTATTCCAAGCTGCTGCTGGCCT

CGAAGGAGCAGGTGCTGCACCGGGTAGTTCTGGAGGAGAAAGGAGCGCTGGAGCAGCAGCTGGCAGAGGAGAAGCACACTCCTGAGTCCTGTTTCATTGA

GGCTGCTATCCAGGAGGTCAAG ATTCGGGAAGAAGCTCTGTCAGGAGTGGCTGGAGGCGGAGGGGAGGTCACTGGTGTTGTGGCTGCTCTGGAACACCT

GGTGCTGATGGCTCCCCTGGCCACGGAGTCTGCTTTCCAACCCAGGAAG GGTGTGCTGGAGTATCTGTCTGCTTTTGATGATGAAGCTGCACAAGTTTG

TTCTCTGGACCCCCCTGGTCCTCTTGCCCTCCCTTTGGTAGAAGAGGAGGAAGCAGTGTCTGAGCCAGAAGCCTGTGAGGACGCAGAGGTAGCCGATGAC

AGTCTGGGAGAGGGGACTGTTGGTCCTGAGATGAGCCAGGAGGAGCCCATCACTAAGCCAGGCTTCACCCAGCTCAGCAGCTCTCCGTGTTACTACTTCT

ACCAGG CGGAAGATGGACAGCACATGTTCCTGCACCCTGTCAACGTGCGCTGCCTTGTGCGGGAGTACGGCAGCCTGGAGCAGAGCCCAGAGAAGATCT

CAGCAACCGTGGTAGAGATTGCTGGGTATTCCATGTCTGAG - UNI613 - GATGTTCGGCAGCGTCATAGGTATCTCTCTCACTTGCCACTCACCTG

TGAGTTCAGCATCTGTGAACTGGCTCTGCAGCCTCCTGTGGTCTCTAAGGAAACCCTAGAGATGTTCTCAG ATGACATTGAGAAAAGGAAGCGTCAGCG

CCAAAAGAAGGCTCGCGAGGAGCGTCGCCGAGAGCGCAGAATTGAGATGGAGGAGAACAAGAGACAGGGCAGGT ATCCCGAGGTCCACATTCCCCTCGA

GAACCTACAGCAGTTTCCGGCCTTCAATTCCTATACCTGTCCCTCTGATTCTGCTTTGGGTCCCACCAGCACTGAGGGCCATGGGGCCCTATCCCTGTCT

CCTCTGAGCAGAAGTCCAGGCTCCCATGCAG - UNI25252 - ACTTTCTGCTGACCCCTCTGTCACCCACTGCCAGTCAGGGCAGTCCTTCCTTCTG

CGTTGGGAGTCTGGAAGACGACTCTCCCTTCCTTTCCTTTGCCCAG ATGCTGAGGGTTGGCAAAGCAAAAGCAGACGGGTGGCCCAAAACTGCTCCAAA

GAAAG ATGACAATAGCTTGGTTCCTCCCGCCCCTGTGGACAGTGATGGGGAGAGTGACAATTCTGACCGTGTTCCTGTGCCCAGTTTCCAAAATTCCTT

CAGCCAAGCTATCGAAGCAGCCTTCATGAAATTGGACACACCAGCTACTTCAGACCCCCTCTCTG ACAGAGGAGGGAAGAAAAGGAAGAGACAGAAGCA

GAAGCTGCTGTTCAGCACCTCGGTCGTCCACACCAAGTGACACTATTGCCCAGGCGCCTTCTCCATCGGGTTTCCTCTCTGTGCTTTTGTTTTGCTGCTG

TAATTTTTAAGTATTTGAGTTTGAACAGATTGATTAGCTTGGGGCGGGGGGAGGGGCTTTCCACAAAGTGAGGGGGAACCAAGAAAATTTTAAATACAGT

GTATTTTCCAGCTTCCCCTCTTTACACCAGAATAAAGTATTGACACTCAACT
Translation
MDKNSGSNS - UNI409 - - UNI2850 - - UNI6067 - - UNI14584 - SSSSNGGRRDE - UNI2850 - - UNI14584 - VAEAQ

RAEFSPAQFSGPKKINLNHLLNFTFEPRGQAGHFEGSGHGGWGKRNKWGHKPFNKELFLQAN NCQFVVSEDQDYAAHFADPDTLVNWDFVEQV - UNI

4709 - RICSHEVPSCPICLYPPTAAKITRCGHIFCWACILHYLSLSEKTWSKCPICYSSVHKKDLKS SVVATESRQYAVGDTITMQLMKREKGVLVA

LPKSKWVNVDHPINLGD DEQLSQYSKLLLASKEQVLHRVVLEEKGALEQQLAEEKHTPESCFIEAAIQEVK IREEALSGVAGGGGEVTGVVAALEHLV

LMAPLATESAFQPRK GVLEYLSAFDDEAAQVCSLDPPGPLALPLVEEEEAVSEPEACEDAEVADDSLGEGTVGPEMSQEEPITKPGFTQLSSSPCYYFY

QA AEDGQHMFLHPVNVRCLVREYGSLEQSPEKISATVVEIAGYSMSE - UNI613 - DVRQRHRYLSHLPLTCEFSICELALQPPVVSKETLEMFSD

 DDIEKRKRQRQKKAREERRRERRIEMEENKRQGRY YPEVHIPLENLQQFPAFNSYTCPSDSALGPTSTEGHGALSLSPLSRSPGSHAD - UNI2525

2 - DFLLTPLSPTASQGSPSFCVGSLEDDSPFLSFAQ MLRVGKAKADGWPKTAPKKD DDNSLVPPAPVDSDGESDNSDRVPVPSFQNSFSQAIEAAF

MKLDTPATSDPLSD DRGGKKRKRQKQKLLFSTSVVHTK

For any suggestions or comments, please send an email to unitrap@crg.es