Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041747 (Utp15)
Chromosomal location
Chr 13: 99016800 - 99032947 (-)
Description
UTP15, U3 small nucleolar ribonucleoprotein, homolog (yeast) Gene [Source:MGI Symbol;Acc:MGI:2145443]
RefSeq_dna
NM_178918 
RefSeq_peptide
NP_849249.1 
UniGene
Mm.28221 
MGI
MGI:2145443 
Uniprot/SWISSPROT
Q8C7V3 
Uniprot/SPTREMBL
Q3TN42 
Human Ortholog
ENSG00000164338 (UTP15)
Omim not available
UniTrap UNI14824
Vector Insertion
Chr 13: 99030753 - 99032948
Public Clones PST7881-NL (escells) PST7881-NR (escells) PST18475-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI864
Vector Insertion
Chr 13: 99029422 - 99030753
Public Clones CB0188 (sanger) CC0812 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI259
Vector Insertion
Chr 13: 99027182 - 99027790
Public Clones GC0417 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4354
Vector Insertion
Chr 13: 99020874 - 99021883
Public Clones AF0314 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24549
Vector Insertion
Chr 13: 99019332 - 99020526
Public Clones not available
Private Clones OST215789 (lexicon)
Severity of mutation (?) Insertion after 85% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040972
Sequence
GGACTGTCCGCGTGATTTTGAGCGAGTGCTGCAGAGCGGTATGCTGTAGGGAGCTGGCGAAGTCTGGGGAGTCGTCCTGGGGATCGGTGCCTCGGTGGAC

CCTCGGGGCCCCGCGGAG - UNI14824 - GCCTGAGGCAGAGTCACTGAAGTTATTGTGAAATTAGTTCCAGACTCCTGACCCTAGGATAACAGCGC

ACTTATATGAAACCATGGCCGGCTATAAACCTGTAGCGATTCAAACATATCCTGTACTTGGTGAGAAGATCACCCAAGACACTCTGTACTGGAACAACTA

TAAG - UNI864 - - UNI14824 - ACCCCTGTTCAGATTAAGGAATTTGGTGCAGTGTCCAAAGTAGACTTTTCTCCTCAGCTTCCATATAACTA

TGCAGTCACAGCTTCTTCGAGA ATCCACATTTATGGCCGGTACTCTCAAGAGCCTGTAAAAACCTTTTCCCGTTTTAAGGACACAGCATATTGTGCGAC

TTTTCGACAGGATGGTCAGTTGCTCGTTGCTGGCAGTGAAGATGGTGTAGTTCAACTTTTTGATATAAATGGGAGGGCTCCCCTCAGGCAGTTTGAAGGC

CACACAAA AGCAGTTCATACAGTAGATTTTACAGCTGACAATTATCATGTGGTCTCTGGAGCTGATGACTATACTGTTAAATTATGGGATATTCCAAAC

TCTAAAGAAATCCTGACATTCAAAGAACATTCTGATTACGTGAGGTGCGGCTGTGCCAGCAAACTGAACCCAGACCTTTTTGTAACAG - UNI259 - 

GATCATACGATCATACTGTGAAGATATTCGATGCTCGGACAAATAAGAATGTTCTCTGTGTGGAGCATGGGCAGCCAGTGGAGAGTGTCCTGCTTTTCCC

CTCAGGAGGGCTTCTGGTGTCTGCAG GAGGCCGCTATGTTAAAGTCTGGGACATGTTAAAAGGAGGACAGCTGCTTGTGTCTTTGAAAAATCATCACAA

GACTGTGACATGTTTGTGTCTGAGCAGCTCTGGACAGAGGTTACTCTCCGGCTCACTGGATAG GAAAGTGAAAGTCTACAGCACCACCTCCTACAAAGT

CGTCCACAGCTTTGACTACGCAGCTTCAATCTTGAGTCTGGCACTCTCT CATCAAGATGAGACGATAGTTGTAGGAATGACCAACGGAATACTGAGTGT

TAAACACCGGAAGTCTGAAGCAAAGAAGACGTCTCTTCCGAGGAGGAGGAGGCCTGCATATCGAACCTTTATTAAAGGAAAAAATTACTTGAAGCAACGG

 GATGACATCATGGTCAGTAGGCCAGCAAAGAAGCACCTAGAGGGGTATGACAAGGATCTGAAAAGCTTTCGGGTCTCACAGGCCCTCGACAGAGTCCTG

GAG - UNI4354 - CCTAAATGTGTGATAAGGACCCCTGAGGTGACAGTTTCCATCATAAAGGAGCTGACTCGGAGAGGCGTCCTTGCCAATGCTCTT

GCAGGTCGGGACGAGAAGGAGGTTACCCGGGTCCTTAACTTTTTGATAAG GAATCTGTCTCAGCCGAGGTTCGCCCCTGTTTTGATTAATGCAGCTGAG

ATCATCATCG - UNI24549 - ATATATATTTACCTGTGATTGGCCAGTCATCAGTAGTTGATAAAAAGTTTATAGTACTTCAAGAACTTGTAGAAAA

AGAAATTGATTACCAAAGAGAACTCCTAGAGACCTTGGGGATGATGGACATGCTATTTGCTACCATGACACGGAATGACAGCGACCCTGTGCCGGAGCAT

GTGCCCGCTGAACTCCCAGAGGAGAAGACAGAGTCACCAACGCAGCCCAGCGACACGGACAAGAACTCCTAACTGGGTGTTGTTTGACTCTATTATGGAG

AAGAAGGCAGCTTCAGTACACTCAAAGGATAATTAAGAGAAGTTTTATGGAAGAGACTGGATTAATTAAAATTGGGACATAAGTACCTGTTTCAAGATGT

GGTTTTCCATGTATTGATTTATTTTATGTTGCCTTCAGCTAGAAGATCTTAGTTGGCTTGGTCACAGTGTCTGTTTACCCTGGATGTGTTAATTCTGACC

TTAATGGAGCCAAAATCTCTGTTGCCGTGGGGCCTCGTGGCCCTCTGGAGAGGTTTCCAAGCGGACAGAGTCCTGCCAAGTGAACAGAGCCCCGGTTTTG

TTTCCTGCTTCTAGCCTGGGAAATAGGAAGAGCAAACAGCAACAACAAAGCATCCATCGCTGTCCCCAGTGTCCTGGGGAGCTTCCTGTCCTCTCGCTGG

TCACTTCAGAGTCTTGAGTCATATGCCTTCCTCAGCTGTTTGTGGGACTGTCTTCCAAGTGTGGCGGATCACTGAATATTGCCCCTGGAAGTGCGTTTAG

GGTGTGATGAGTCTGTTTTGTCACCTAAAAATTGTGCCCTCCACCAGTGTGTTCTTTAGCCTTGTGTGTCCAGAGAGCTCTGACTGAACCAATTCCCGCC

CCTCAGCCTGCTTCCTTCCTTCCGTCTTCACCGTGCTTTGGTTGTCCTCTCCTCTATAGTAAAGGCCTTTCAGCCTGCCCATGTGCTTTGGCAAAGTGTA

TCATGAATATGTAACCCTCCATAACGATTCTCTTATCTGTCCTTCACATTTCTTTTTCTCTGTCCTTCACTTTCTGGGTCAGACTCAAACGGCAGCAGTT

TGCTTTGAGAATTTATGTTTCTGAAAGTTCATTGTAAATTATATTTTTTTATAAAGAGATTCTTTTCTTCTTGGCTTTCTGAGGTGTTCCTGATGGGCAG

TCAGTGGCTTTGACCAGCATACTGACTGCACGGCTGTGACTTCCGTGCCTTCCTTCAGTGACCCCACTTAGGTTAATAAATGTCTGGTGATGGAATCCCG

AGCCGAGGATGTCCTTGGGGGAAAGATTGTAATGATTCTGCCTCATAATCTCACTTGTGTAAATTTAGGGTTTTTTTTTTTTTTCTTTTTCCCAAGACAG

GGTTTTTCTGTGTAGCTTTTGCTGTCTTGGAAATCACTGTGACCAGACTGGCTTCGAACTCAGAGACCCACCTGCCTTTGCGTTTCAAGCGCAGGAATTA

AAGGTGTGTTCCACCATCCAACTAACTGTAGGTTTTCTGAAAGCACAAGGGGGTACAGTAAGACTGTTCTGATGTGTACCCATGTTCAACAGTAGGTACA

GCGTCCTTTCATGAGCTGAAGCAGTTCTGCAGTACAGCGGCTTGTGAGGTGCCTGGCTTGCTTTGAGTAAGGAATTATTTAAATAACTCTTGTTAGGTAT

GCAGAGAGCTTACAGGAGCAGTTGCGAGTCTGCTGGAAGCTGTAGCTGCCATCTCCTGTGCACCTCTGCAGCGTTTCTTGGATCATTTCATTCTTGTCAT

AGCTATCCAAGGGTTGAATCATTCTCTTATAGAACCCTGAATTAATTAAAGTCACTCACCTCTCCACGCTGCTGTCCTTATCATTCCTGCACTGGGCTGG

TCTGTGAGGGCCTTAACTACTCGTTCCCTTTGACAGACGAGAGTGCTGCAGCTCCTGTAAGGAATGTGTAGTAATTACAAACCCTTAAAAGGACCAGGGA

CCTCAGAGTCCTCAATGTAGTTGTGTTCAGGAGTGGGCTTTTGTTTTGTTTTTTAGTGACAGGCTTCTCCAGGTAACCCTGGCTGTCCTGGAATTCACTA

TGTAGACTGGGCTGGCCTCGAACTCACAGAGATCCACATGCCTCCCAGCCTTCCAAGCGCTGGGAGTTAAAGGTGTGCACCACCACAGCTCAGGAGTTGT

TTTTATATTCCCTGAAACTATTACCTGCTATGTGAAGTGTTTTAACACAATAACATGTTTCAATATATAATGTTGGCTTTAAGAGTCAAATGCCTAATCA

TTTTTAGATTTGTGATTTTAAGTTGGGAAGTATTTTATACTTTACTATTGATGTAAAAATAATGAATTGTTGCTGGGAACTAGTCATTTTTGTTTAATTT

ATTATGTTAATTCAGATTTCTACATATGGAAAAGGATTGCTTGTTTCCAGTCAAATTTCTTAAATGTCTGTGCTCTTAAGTTGCTGAAGCAACTGATGTT

AAATGGGACCATTAGAAACACTGCTGATTTAACTTAAATGAATTTTGCCAAATATT
Translation
 - UNI14824 - MAGYKPVAIQTYPVLGEKITQDTLYWNNYK - UNI864 - - UNI14824 - TPVQIKEFGAVSKVDFSPQLPYNYAVTASSR

 IHIYGRYSQEPVKTFSRFKDTAYCATFRQDGQLLVAGSEDGVVQLFDINGRAPLRQFEGHTK KAVHTVDFTADNYHVVSGADDYTVKLWDIPNSKEIL

TFKEHSDYVRCGCASKLNPDLFVTG - UNI259 - GSYDHTVKIFDARTNKNVLCVEHGQPVESVLLFPSGGLLVSAG GGRYVKVWDMLKGGQLLVS

LKNHHKTVTCLCLSSSGQRLLSGSLDR RKVKVYSTTSYKVVHSFDYAASILSLALS HQDETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIK

GKNYLKQR DDIMVSRPAKKHLEGYDKDLKSFRVSQALDRVLE - UNI4354 - PKCVIRTPEVTVSIIKELTRRGVLANALAGRDEKEVTRVLNFLI

R RNLSQPRFAPVLINAAEIIID - UNI24549 - DIYLPVIGQSSVVDKKFIVLQELVEKEIDYQRELLETLGMMDMLFATMTRNDSDPVPEHVPAE

LPEEKTESPTQPSDTDKNS

For any suggestions or comments, please send an email to unitrap@crg.es