Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041765 (Ubac2)
Chromosomal location
Chr 14: 122277828 - 122420256 (+)
Description
ubiquitin associated domain containing 2 Gene [Source:MGI Symbol;Acc:MGI:1916139]
RefSeq_dna
NM_026861 
RefSeq_peptide
NP_081137.2 
UniGene
Mm.441151 Mm.474943 
MGI
MGI:1916139 
Uniprot/SWISSPROT
Q8R1K1 
Human Ortholog
ENSG00000134882 (PHGDHL1)
Omim not available
UniTrap UNI5129
Vector Insertion
Chr 14: 122277997 - 122304344
Public Clones (sanger) YTC317 (baygenomics) YHB028 (baygenomics) BGD013 (baygenomics)
BGD062 (baygenomics) A033A02 (ggtc) IST11684G4 (tigm) IST14278B3 (tigm)
IST14788D12 (tigm)
Private Clones OST416049 (lexicon) OST360095 (lexicon) OST131638 (lexicon) OST66167 (lexicon)
OST39709 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17270
Vector Insertion
Chr 14: 122304473 - 122306512
Public Clones not available
Private Clones OST446163 (lexicon) OST434551 (lexicon) OST405941 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30085
Vector Insertion
Chr 14: 122307543 - 122372830
Public Clones D121E07 (ggtc) (ggtc) IST14836F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4052
Vector Insertion
Chr 14: 122393693 - 122408012
Public Clones AQ0316 (sanger)
Private Clones OST197587 (lexicon) OST59512 (lexicon) OST59249 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI841
Vector Insertion
Chr 14: 122408136 - 122419171
Public Clones CH0010 (sanger) XS0767 (sanger) XS0234 (sanger) RRQ018 (baygenomics)
RRS639 (baygenomics) RRS647 (baygenomics)
Private Clones OST21063 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039803
Sequence
TTCCTGGCGGCTCCGGAGCGCCTCGCCGGGCCGACTTCGCTCGCTGGTTGACAGTGCGCCTGCGCGGTCGCTGGGGGCTCTCCACCTCTGCCTCCCCTCC

CCCTGACGCCCCGCGGGGGCTCCGGGCCCGGCGGGACCATGTTCACCAGCACCGGCTCCAGTGGGCTTT - UNI5129 - ATAAGGCACCTCTGTCGA

AGAGTCTTCTGCTGGTCCCCAGTGCCCTGTCCCTCCTGCTGACTCTCCTGCTGCCTCACTGTCAGAAGTTCTTCGTGTATGACCTCCATGCTGTCAAGCA

CGACTTGCAG - UNI17270 - ATTTGGAGGCTGATATGCGGAAGAATAATTTGCCTTGACTTGAAAGACGCTTTCTGTAGTGGTCTTCTCATTTATA

ACTTCAGAATATTTGAAAGAAGATATGGAAGCAGGAAGTTCGCA TCCTTCTTGCTGGGTTCCTGGGTCTTGTCAGCCTTGTTTGATTTTATCCTCGTGG

AAGCCGTGCAGTATTCGCTTGGTGTCACAGTGGCCAGCAACTTACCTTCTGGATT - UNI30085 - CTTGGCGCCCGTGTTCGCTCTCTTTGTTCCA

TTTCACTGCTCCATCCCAAGAGTCCAGGTGGCGCAGATCCTGGGCCCGTTGTCCATCACAAACAAGACATTGATTTATATATTGGGACTACAG CTTTTC

ACCTCTGGGTCCTACATCTGGATTGTAGCCATGAGTGGACTT ATCTCTGGCATGTGCTATGACCGCAAAGTGCTCCAGGTCCACCAGGTGCTCCGCATC

CCTGGCAGAATGGCCGAGTTCTTCTCCTGGGCCCTTGAGCCCATCTTCTCATCTTCAGAACCCACCAGCGAGGCCAGGGTTGGGATGGGAGCCACCGTGG

ACATCCAGAGACAGCAGAGGATGGAGCAGCTGGACCGGCAGCTGATGCTCTCTCAGTTTGCACAAGTGAGGCGTCAAAGGCAGCAGCAG - UNI4052 

- GGAGGAATGATCAATTGGAACCGGCTTTTCCCCCCTTTACGTCAGCGACGAAATATCAACTATCAAGATGGACCTCGGTCTGAGCAGCGAGCATCTCC

TCCCCTGGAAGTTTCTGAAGAGCAG - UNI841 - GTTGCCCGCCTCATGGAGATGGGATTTTCCAGAGGGGACGCCTTGGAGGCCCTGAGGGCCTCA

AACAATGACCTCAATGTGGCCACCAACTTCCTGCTGCAGCACTGACATCCAGCCACTGTATGACAGTGATGTGCCCGCCACCACATCAGCCTGAGGACCA

AGCAGACCCCAGCACAGGTGTTCTCAAGAGGAGACGGTGGTTCCCACCATACACTGTCCTTAAATCCAAGATGGTTGCCGTGTAGTATCAAATAAGTTTG

CCATTAAATTAGCATGTATTTTCTATCTTTATTTTTTTACTGGGCATTTCTCAGTGTGGAGAGCCGTCATTCTTACGTGTTCAAATGCATGACGGTTACA

GGTTTCGGTGGCTGTTTTATAGCACCGCAGAGAGAGACAACTGTCCTGAAGCTCGAGTGCAGTCTGCTCATCCTCACGTCAGGGAAGGGCGGCAGGCCAT

GTGACCTCAGAAAGGCTGTGTCACACTACTCTGTATGGACTGGGTTTTTTTTCTCTTCAGTTTGTATTCACATCTCAGTGACAGAGGGAGCTGGAGATGA

GCCTCCTCCAGCCTAGAGTCTGCCCCAACTCCTGCTTTCAGTACAGATAATCCAGTGCTGGTGTGAGGTTCTAGAATGCCCCGTGATGCCTACCTGGGGT

CATTTTGCTCAGAATGCATTACAGTGGCCACTTGGGCAAAGGAGTGAATTGGAATAAAGAAAAAAGTTGCTTCAGAGACTTAGTGGGGCTGTGCAGAGAG

CAGGCGCTGGCCAGCAATGGCTCAGCCCCGGCCTGCCCACCCTGGGCCAGCCTGCAGCCCTCCATACACCACCAGCCCTTCTGGCAGCACACCTTCCCTG

GCCCCATCCTTGCCCCTTGTAGTGGGTGAGGCAGTGCCCACTGTGCAGACAGTCAGGGAGGTGTAAGCAGGAGGCAGCCCCTGTGAGCAAGAGCAGCTGT

AGGAATTGACGACTGTCCCGTAAGCAAACTGCACCGGGTGTATTCTGCACAGTGAGCAGCAATGTGTCAAATTGATGCAAATCTAGGTGTGTGATACTTA

CAATAAAGTTTTTATGTGTTTT
Translation
MFTSTGSSGLY - UNI5129 - YKAPLSKSLLLVPSALSLLLTLLLPHCQKFFVYDLHAVKHDLQ - UNI17270 - IWRLICGRIICLDLKDAFC

SGLLIYNFRIFERRYGSRKFA SFLLGSWVLSALFDFILVEAVQYSLGVTVASNLPSGF - UNI30085 - FLAPVFALFVPFHCSIPRVQVAQILGP

LSITNKTLIYILGLQ LFTSGSYIWIVAMSGL ISGMCYDRKVLQVHQVLRIPGRMAEFFSWALEPIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQL

MLSQFAQVRRQRQQQ - UNI4052 - GGMINWNRLFPPLRQRRNINYQDGPRSEQRASPPLEVSEEQ - UNI841 - VARLMEMGFSRGDALEALR

ASNNDLNVATNFLLQH

For any suggestions or comments, please send an email to unitrap@crg.es