Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041773 (Enc1)
Chromosomal location
Chr 13: 98011060 - 98022988 (+)
Description
ectodermal-neural cortex 1 Gene [Source:MGI Symbol;Acc:MGI:109610]
RefSeq_dna
NM_007930 
RefSeq_peptide
NP_031956.3 
UniGene
Mm.241073 Mm.472435 
MGI
MGI:109610 
Uniprot/SWISSPROT
O35709 
Uniprot/SPTREMBL
Q8BRG4 Q8C7V2 
Human Ortholog
ENSG00000171617 (ENC1)
Omim not available
UniTrap UNI10881
Vector Insertion
Chr 13: 98011485 - 98014925
Public Clones (sanger) H011H03 (ggtc) P089C06 (ggtc) D185E09 (ggtc) P103B07 (ggtc)
P091D03 (ggtc) D042C12 (ggtc) P094H12 (ggtc) PST5978-NR (escells) PST18305-NR (escells)
PST22493-NR (escells) IST14999D4 (tigm) IST14341G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18870
Vector Insertion
Chr 13: 98016740 - 98020491
Public Clones not available
Private Clones OST412698 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041623
Sequence
GCAGTCAGCTCCCGCAGCCTCAGAGCCAGCGGCGCGACGGAGGCGCTGCAGAGACCCGGAGCCGACGCCAGGCGGCCGCCAGCGCTCACGCCGCAACCCC

GTTCCCTCCCCCTGCGTGCAGACCGCCTTCCTCCGCGGCGCGGCCGCCGCAGGCTCACTCTCCCCTGGCTAGGCGCGCGCCGGCAGACGCTTGGCCCGGC

CGGGGCGCCAGGTCCGTAGCAGCAGATCCGGAGACCGAGGTCAGCTGCCTGCCGAAACCAGCCCGGGAGCCACTACCCCGGACGCTATCGCCTCCCTTCC

CAGCGCTCCTTTCTCCCCGGCGATCGCCACCGCTTCCTGGAACAGAGACGCCCTTCGTCGGCTCCCTGCGGGTGACCGAGGCAAGAACCGCAGCCGGTTG

TGTGCAGAGGCCAGCCGCCACTACT - UNI10881 - GAGTTGAAACAAAATGTCAGTCAGTGTGCATGAGAACCGCAAGTCCAGGGCCAGCAGTGGC

TCCATCAACATCTACCTGTTTCATAAGTCCTCCTACGCGGACAGCGTTCTCACTCACCTGAACCTTCTGCGTCAGCAGCGGCTCTTCACAGATGTCCTTC

TCCATGCGGGAAACAGGACCTTCCCTTGCCACCGGGCAGTGCTGGCTGCGTGCAGCCGCTACTTCGAAGCCATGTTCAGTGGTGGCCTGAAAGAGAGCCA

GGACAGTGAGGTGAACTTCGACAATTCCATCCACCCAGAAGTCTTAGAGCTGCTTCTAGACTACGCATACTCCTCCCGGGTCATTATCAATGAAGAAAAT

GCTGAGTCGCTCCTGGAGGCTGGTGACATGCTGGAGTTCCAGGACATCAGAGATGCGTGTGCAGAATTTCTAGAGAAGAACCTGCATCCCACCAACTGCC

TGGGTATGCTGCTGTTGTCTGATGCCCACCAGTGCACCAAGCTGTACGAACTCTCCTGGAGAATGTGTCTCAGCAACTTCCAAACCATTCGGAAGAACGA

AGATTTCCTCCAGTTGCCCCAGGACATGGTTGTGCAGCTGCTGTCCAGTGAAGAACTGGAGACGGAAGACGAAAGGCTGGTGTATGAGTCTGCGATGAAC

TGGATCAGCTATGACCTGAAGAAGCGCTACTGTTACCTCCCGGAACTGTTGCAGACAGTGAGGCTGGCCCTCCTTCCTGCCATCTATCTCATGGAGAACG

TGGCGATGGAAGAACTCATCACCAAGCAGAGAAAGAGTAAGGAGATCGTGGAAGAGGCCATCAGGTGCAAACTAAAAATCTTACAGAATGACGGCGTGGT

CACCAGTCTCTGTGCTCGTCCTCGGAAAACTGGCCATGCCCTGTTCCTCCTGGGAGGGCAGACTTTCATGTGTGACAAACTGTACTTGGTAGACCAGAAG

GCTAAAGAAATCATTCCCAAGGCTGACATTCCCAGCCCGAGGAAAGAGTTCAGCGCATGTGCAATTGGCTGCAAAGTATATATTACTGGGGGGCGGGGAT

CAGAGAACGGAGTCTCAAAAGATGTCTGGGTTTACGATACCCTGCATGAGGAGTGGTCCAAGGCTGCCCCCATGCTGGTGGCCAGGTTTGGCCATGGATC

TGCTGAACTGAAGCACTGCCTCTATGTAGTCGGTGGGCACACAGCTGCAACTGGCTGCCTCCCAGCCTCCCCCTCGGTCTCCCTAAAGCAAGTAGAACAG

TATGACCCCACAACCAACAAATGGACCATGGTAGCCCCACTCCGCGAAGGTGTCAGCAATGCTGCTGTAGTGAGTGCCAAACTTAAGCTGTTTGCTTTCG

GGGGTACCAGTGTGAGCCACGACAAGCTGCCCAAGGTTCAGTGTTACGATCAATGCGAGAACAGATGGTCAGTGCCGGCCACCTGTCCCCAGCCCTGGCG

TTACACAGCCGCAGCTGTGCTGGGAAACCAGATTTTTATCATGGGTGGAGATACAGAGTTCTCTGCCTGCTCCGCTTACAAATTCAATAGTGAGACTTAC

CAGTGGACCAAGGTGGGAGATGTGACAGCCAAGCGCATGAGCTGCCACGCCGTGGCGTCCGGGAACAAGCTTTACGTAGTTGGAGGGTACTTCGGCATTC

AGCGCTGCAAGACTTTGGACTGTTACGACCCAACTTTAGATGTGTGGAACAGCATAACCACTGTTCCCTACTCTCTGATCCCTACTGCATTCGTCAGCAC

CTGGAAACACCTGCCTTCCTAATGTAGAGCATCCTAAAGAAAGCACGCATGAG - UNI18870 - CTCATTCTGATGCACGGCGAGATGAGATGTCAT

TTCTGCTTTGGAGAAGGCAAGTTTAATGAAGAGAAAGAAAAACAGGAGCAGTTGCTACTGAGACTCCTCGAATACCATCGGCTGCACCTTGCAAACACTC

TCAAGTGGACATGAAGGAAGGGGTGGGGGGAGGGGCGGGTTTTTTTTTTTTCAATATAAGTAGCACATGGTTTAAATATGAATGACTGAACTTGTGATCT

AGTCCTTGTCTGGTAATTGTGGATTAATGTCAGCGTTAATCAGCCCCTCAAAGGGAGAGAAAAGCTGGGCTTTTCCCTTGCTGTACCTCATTCAGCTTTT

GATTTCCATGGCCCCACCATTTATGTGCAAGATTTGCAATGGTTGTCAGCTTCCTCTGAAGACCGAGCTTGACGCCTCCATGCCAGCTGCCGTTGGAGAC

GCAAAGCCAAGCAAGGGTCAGGAGGGAAGCTGGCCCGGCTGACTGGAGAATGGGAACCCCAGGACTCTCCACTCATCTCGAAGGGTTGTGGTCCCCCCAG

GAAAGTCTCGAGACAATGGGGACATTGTTGGTAGCTGTTCGGTAGATGCTCTTTGCTATTTATAAGTGACTTTAAACCTTCTCTTGGCTGTTAAGAAATG

TGTTCTAGATTTAGCTATTTATTGTTTGCGGCCTGCATGCTGAAACAGTGCTTACGTTGTCTCCATGTGTACGGGGCCTGTGTGGATGGTCGTATGTTTT

GCACATTTTGTAGTTGTTGGTGTGCTTCGCCGCACACAAAAAAAGAAGACTTTGGGGCTGTAATTTGGAGGATAAGTAGAGGGTGGGTGGGGGGAGGGGT

ACATTTTTGAAGTGTCGGGACAGAGACAGATTCCAAGACTGGAAACTTCAATTACATCCAGAGGCAGAGAAACCTTTCCTCGACCACTCTTTATTGAGGT

ACCCTGGTCACACTGATGGCAGGACACACAAGAGCAGGGTATTGGTCTGCCCTTCTTCCTCCTGTCCGTCTGATTTACCTAACTTTGGTCTCGGCTGCTG

ACTCTTGGAGAGGACCAAATTACTTTGTAGTATTTCCCCCGTTTGTGTAATGTCCTGAAACCTTGGAGAGGTTCCAGAATACTTCTGTATATAGGGCACA

GGTGAAGACATTGTCCAAAGCTTATTTATTTATCTATTTATTTACCCTGGGCGAGTAACCACACCAGTGGGGGGGAAAAAACTAAAATGTGTGGAGTGTA

AACAAACTCACTGACCACGTGGCTCTTGGACCTTGATTTAGAAAGGCTCATACTCCCAGGAAAACACCCATTTTGATACAATGTAAACGTTCGTGTTCAC

CCTTGGATACATGTTGAAAGAGCTCTTTGGTACACGGAAGTGACATCTTTGGGGTCAGTGTTACGAGGTGGCCTGTGGAGGTCTTCCGGTCCTGTTGGGA

TCATTTGTGAATACATTCTTTGCTCCTCTTAAGTGCTTGTTTCCTAACCGTGCAGTGGTAGGTATTAGTACACTGGGCACTTCCCCAGGGATCTGGGGAA

GACCAGAGCTTGCAGCTCTGCCTGCTTTGATCCATATTTCTCACAGTGCTGTATTAAAAAATAGAACCTAAGGCAGATAGCCACCTTTACATTGTGAGTG

TGTTTACCTTGTCTAATGACGGATAATTCCTTAACATTTCTCTCCACCTTAGTACTTTAGGCTAATTATACACGTCTGTCTGTGCCATGAGTAAGTGGAC

TGTAGTTGGACCAAAAAAACAAATGAGCCGTTGGACCATTTGAGCAGTCAGTTTCTGGTCCTTAGATGTATTCTAAGCAGTGTAAGTGTCTGATTGTACC

CTGGTGGCATGATCAGTTGTCTTGTAGCTGTCCCCCGCTCCATAGTTTACAATGCAAATCTGTCTCAAGATCTTCACTTCGCTGCTGCTGAGAGCAGGAG

AATTTTCTGCAGCTGTTTCAAAGTTGTGGCCTGGCCTTGAATCCTCTATTAATTACTGTGTGAGCCAGAGGGAACTGCCCTGCAAGGGTGGGCCCCCAGC

CGGCAGGGGAACTTTCTAGACTCCCGCTCATTCAATTGATCTAGGCATTTGGGCTTGCTACTTGACCATTCTCGCCCTGTGAAATGTCCCACACTTTGAA

GCAAATACAATTCACAGCACAGTACACACAAAAACCCTGGCATAAGACGGGGAGGTTCTTCTTATTTTGTGAGCCGGTTGCCCTGGAAACGGATAACAAA

GGGCAGCCTTCCACTTCTGGTATAATGGGGGAGCCTCTTTTCTCAGGCTTGACACCTGTCTGAATAAGAGTGATTAGAGCCGCATAATATCCCTCTCTTG

GCTATTGAATAAGTGGTTCACATACCCAACCCTGTAGAAGTTAGAAGATGGTCGGTCATGTCTGTATGTTCTTGTTTGCATCTACTACATTTTTAAGGTT

TTGTAAAACTGTTATTTTTTTTTCACGATGTGAAACTGAAGGTCAATAAATTATTAGAGATTTT
Translation
 - UNI10881 - MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRYFEAMFSGGLKESQDSE

VNFDNSIHPEVLELLLDYAYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFL

QLPQDMVVQLLSSEELETEDERLVYESAMNWISYDLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSL

CARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAEL

KHCLYVVGGHTAATGCLPASPSVSLKQVEQYDPTTNKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWSVPATCPQPWRYTA

AAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKH

LPS - UNI18870 - 

For any suggestions or comments, please send an email to unitrap@crg.es