Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041798 (Gck)
Chromosomal location
Chr 11: 5800823 - 5849602 (-)
Description
glucokinase Gene [Source:MGI (curated);Acc:Gck-004]
RefSeq_dna
NM_010292 
RefSeq_peptide
NP_034422.2 
UniGene
Mm.220358 
MGI
MGI:1270854 
Uniprot/SWISSPROT
P52792 
Uniprot/SPTREMBL
Q5SVI6 Q5SVI5 
Human Ortholog
ENSG00000106633 (GCK)
Omim 125851 - MATURITY-ONSET DIABETES OF THE YOUNG, TYPE 2  602485 - HYPERINSULINEMIC HYPOGLYCEMIA, FAMILIAL, 3  606391 - MATURITY-ONSET DIABETES OF THE YOUNG  
UniTrap UNI32665
Vector Insertion
Chr 11: 5814969 - 5849603
Public Clones IST14791A3 (tigm) IST12453C11 (tigm) IST12310F5 (tigm) IST10949H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109822
Sequence
GTCCTTGGCTGCCTGTCTTTTGCAACACTCAGCCAGACAGTCCTCACCCACAGCAGGTGGCCTCGGGAGTCAGGAACATCTCTACTTCCCCAACGACCCC

TGCTTATCCTCAGATGGCTGTGGATACTACAAGGAGGGGAGCCCAGTCGTTGACTCTG - UNI32665 - GTAGAGCAGATCCTGGCAGAGTTCCAGC

TGCAGGAGGAAGACCTGAAGAAGGTGATGAGCCGGATGCAGAAGGAGATGGACCGTGGCCTGAAGCTGGAGACCCATCAGGAGGCCAGTGTAAAGATGTT

GCCCACCTACGTGCGTTCCACCCCAGAAGGCTCAG AAGTTGGAGACTTTCTCTCCTTAGACCTGGGAGGAACCAACTTCAGGGTGATGCTGGTGAAAGT

GGGGGAGGGGGAGGCAGGACAGTGGAGCGTGAAGACGAAACACCAGATGTATTCCATCCCCGAGGACGCCATGACGGGCACTGCGGAGATG CTCTTTGA

CTACATCTCTGAGTGCATCTCTGACTTCCTGGACAAGCATCAGATGAAACACAAGAAACTACCCCTGGGCTTCACCTTCTCCTTCCCTGTAAGGCACGAA

GACATAGACAAG GGCATCCTGCTCAACTGGACCAAGGGCTTCAAGGCCTCCGGAGCAGAAGGGAACAACATCGTGGGACTTCTCCGAGATGCTATCAAG

AGGAGAGGG GACTTTGAGATGGATGTGGTGGCAATGGTGAATGACACGGTGGCCACAATGATCTCCTGCTACTATGAAGACCGCCAATGTGAGGTCGGC

ATGATTGTGG GCACCGGCTGCAACGCCTGCTACATGGAGGAGATGCAGAATGTGGAGCTGGTGGAAGGCGATGAGGGGCGCATGTGTGTCAACACAGAG

TGGGGCGCCTTCGGGAACTCCGGTGAGCTGGACGAGTTCCTCCTGGAGTACGACCGGATGGTGGATGAGAGCTCAGTGAACCCCGGTCAGCAGCT GTAC

GAAAAGATCATTGGCGGAAAGTACATGGGCGAGCTGGTACGACTTGTGCTGCTCAAGCTGGTAGAGGAGAATCTTCTGTTCCACGGAGAGGCCTCAGAGC

AGCTGCGCACACGTGGTGCTTTTGAGACCCGTTTTGTGTCGCAGGTGGAGAG CGACTCTGGGGACCGAAGGCAGATCCTTAACATCCTGAGCACTCTGG

GCCTTCGACCCTCTGTCGCCGACTGCGACATTGTGCGCCGTGCCTGTGAAAGCGTGTCCACTCGCGCCGCCCACATGTGCTCAGCAGGACTAGCGGGGGT

CATAAATCGCATGCGCGAAAGCCGCAGTGAGGACGTGATGCGCATCACGGTGGGCGTGGATGGCTCCGTGTACAAGCTGCACCCGAG CTTCAAGGAGCG

GTTTCACGCCAGTGTGCGCAGGCTGACACCCAACTGCGAAATCACCTTCATTGAATCAGAGGAGGGCAGCGGCAGGGGAGCCGCACTGGTCTCTGCGGTG

GCCTGCAAGAAGGCTTGCATGCTGGGCCAGTGAAATCCAG GAGATGCCAGAGGATAGAGGCCCAGAGTCCTTGCTCTAGGGGACCTGAAGGGGAGCGCC

TCACTCTGCACTGTTAGCAGGATGGCAGCTTCAACACTCACATCAGTGATCCGGGAAGAGAAGCAAGCCACCCACAGCATCTCTCCAGGAAACCACCCAG

GTCCCTCTGTCCCTCATCCCTGTCAGGTTTCCCAGATGCCATGCCGCCCTCTCCACACCAGCTTGGAACCATGGGGGAGTTTTTAATTAAATATTTAAAA

CTACTTAAA
Translation
MAVDTTRRGAQSLTL - UNI32665 - VEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPTYVRSTPEGSE EVGDFLSLDLGGTNF

RVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAEM LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDK GILLNWTKGFKASGAEGNNIV

GLLRDAIKRRG DFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVG GTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDE

SSVNPGQQL LYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES SDSGDRRQILNILSTLGLRPSVADCDIVRRACESVS

TRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPS SFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ 
Transcript ENSMUST00000109823
Sequence
ATGGCTGTGGATACTACAAGGAGGGGAGCCCAGTCGTTGACTCTG - UNI32665 - GTAGAGCAGATCCTGGCAGAGTTCCAGCTGCAGGAGGAAGA

CCTGAAGAAGGTGATGAGCCGGATGCAGAAGGAGATGGACCGTGGCCTGAAGCTGGAGACCCATCAGGAGGCCAGTGTAAAGATGTTGCCCACCTACGTG

CGTTCCACCCCAGAAGGCTCAG AAGTTGGAGACTTTCTCTCCTTAGACCTGGGAGGAACCAACTTCAGGGTGATGCTGGTGAAAGTGGGGGAGGGGGAG

GCAGGACAGTGGAGCGTGAAGACGAAACACCAGATGTATTCCATCCCCGAGGACGCCATGACGGGCACTGCGGAGATG CTCTTTGACTACATCTCTGAG

TGCATCTCTGACTTCCTGGACAAGCATCAGATGAAACACAAGAAACTACCCCTGGGCTTCACCTTCTCCTTCCCTGTAAGGCACGAAGACATAGACAAG 

GGCATCCTGCTCAACTGGACCAAGGGCTTCAAGGCCTCCGGAGCAGAAGGGAACAACATCGTGGGACTTCTCCGAGATGCTATCAAGAGGAGAGGG GAC

TTTGAGATGGATGTGGTGGCAATGGTGAATGACACGGTGGCCACAATGATCTCCTGCTACTATGAAGACCGCCAATGTGAGGTCGGCATGATTGTGG GC

ACCGGCTGCAACGCCTGCTACATGGAGGAGATGCAGAATGTGGAGCTGGTGGAAGGCGATGAGGGGCGCATGTGTGTCAACACAGAGTGGGGCGCCTTCG

GGAACTCCGGTGAGCTGGACGAGTTCCTCCTGGAGTACGACCGGATGGTGGATGAGAGCTCAGTGAACCCCGGTCAGCAGCT GTACGAAAAGATCATTG

GCGGAAAGTACATGGGCGAGCTGGTACGACTTGTGCTGCTCAAGCTGGTAGAGGAGAATCTTCTGTTCCACGGAGAGGCCTCAGAGCAGCTGCGCACACG

TGGTGCTTTTGAGACCCGTTTTGTGTCGCAGGTGGAGAG CGACTCTGGGGACCGAAGGCAGATCCTTAACATCCTGAGCACTCTGGGCCTTCGACCCTC

TGTCGCCGACTGCGACATTGTGCGCCGTGCCTGTGAAAGCGTGTCCACTCGCGCCGCCCACATGTGCTCAGCAGGACTAGCGGGGGTCATAAATCGCATG

CGCGAAAGCCGCAGTGAGGACGTGATGCGCATCACGGTGGGCGTGGATGGCTCCGTGTACAAGCTGCACCCGAG CTTCAAGGAGCGGTTTCACGCCAGT

GTGCGCAGGCTGACACCCAACTGCGAAATCACCTTCATTGAATCAGAGGAGGGCAGCGGCAGGGGAGCCGCACTGGTCTCTGCGGTGGCCTGCAAGAAGG

CTTGCATGCTGGGCCAGTGAAATCCAGGCAAGGACAGGGACCTGGGTTCCACGGGGACTCCACACCCCACAAATGCTCCCAGTCCACTAGGGCAGGAGAC

CTATTCTGCTGCTACCCCTGGAAAATGGGGAGAGGCCCCTGCAAGCCAAGTCAGCCAGTGAGACAGCCCTAGGGCTCTCAGCCTGGGGCAAGGGGCAAGA

GGATCAGCGGCACCAAAAGCCTTTCTTGCTAGAATCAACTACAGAGAAAGGTGAAGCACACTCAGGTCTTGCTCTTTCAGCTTCTGGCCTCCCACAGCTG

TGGGTCTGGCCTCCCAAGGGAGTGCCTCCTGGACTTGCAATGGCCTGGCTTCCCTGGGAACACATCTCCATGGGGAGGTAGCTTCAGCAGCTTGGCCAGA

CCAGACCTGGGCCCCCAGAAGAGTAAGGGCTGCCCAGACCTGGCTGTTTTCTTGCCTGTGGCTGAAGAGGCTGCAAAACCATGGGAGACCGACTATCTAG

CTACATGGAGGGGACTTTCCAGGCCACAAACATTCCAGAGACAGTCTCCTTCATATACCTCCACCCCTGAGTGGCTTACAGTTCTGGGATGAACCCTCCT

AGGAGATGCCAGAGGATAGAGGCCCAGAGTCCTTGCTCTAGGGGACCTGAAGGGGAGCGCCTCACTCTGCACTGTTAGCAGGATGGCAGCTTCAACACTC

ACATCAGTGATCCGGGAAGAGAAGCAAGCCACCCACAGCATCTCTCCAGGAAACCACCCAGGTCCCTCTGTCCCTCATCCCTGTCAGGTTTCCCAGATGC

CATGCCGCCCTCTCCACACCAGCTTGGAACCATGGGGGAGTTTTTAATTAAATATTTAAAACTACTT
Translation
MAVDTTRRGAQSLTL - UNI32665 - VEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPTYVRSTPEGSE EVGDFLSLDLGGTNF

RVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAEM LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDK GILLNWTKGFKASGAEGNNIV

GLLRDAIKRRG DFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVG GTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDE

SSVNPGQQL LYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES SDSGDRRQILNILSTLGLRPSVADCDIVRRACESVS

TRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPS SFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ
Transcript ENSMUST00000036050
Sequence
ATGCTGGATGACAGAGCCAGGATGGAGGCCACCAAGAAGGAAAAG - UNI32665 - GTAGAGCAGATCCTGGCAGAGTTCCAGCTGCAGGAGGAAGA

CCTGAAGAAGGTGATGAGCCGGATGCAGAAGGAGATGGACCGTGGCCTGAAGCTGGAGACCCATCAGGAGGCCAGTGTAAAGATGTTGCCCACCTACGTG

CGTTCCACCCCAGAAGGCTCAG AAGTTGGAGACTTTCTCTCCTTAGACCTGGGAGGAACCAACTTCAGGGTGATGCTGGTGAAAGTGGGGGAGGGGGAG

GCAGGACAGTGGAGCGTGAAGACGAAACACCAGATGTATTCCATCCCCGAGGACGCCATGACGGGCACTGCGGAGATG CTCTTTGACTACATCTCTGAG

TGCATCTCTGACTTCCTGGACAAGCATCAGATGAAACACAAGAAACTACCCCTGGGCTTCACCTTCTCCTTCCCTGTAAGGCACGAAGACATAGACAAG 

GGCATCCTGCTCAACTGGACCAAGGGCTTCAAGGCCTCCGGAGCAGAAGGGAACAACATCGTGGGACTTCTCCGAGATGCTATCAAGAGGAGAGGG GAC

TTTGAGATGGATGTGGTGGCAATGGTGAATGACACGGTGGCCACAATGATCTCCTGCTACTATGAAGACCGCCAATGTGAGGTCGGCATGATTGTGG GC

ACCGGCTGCAACGCCTGCTACATGGAGGAGATGCAGAATGTGGAGCTGGTGGAAGGCGATGAGGGGCGCATGTGTGTCAACACAGAGTGGGGCGCCTTCG

GGAACTCCGGTGAGCTGGACGAGTTCCTCCTGGAGTACGACCGGATGGTGGATGAGAGCTCAGTGAACCCCGGTCAGCAGCT GTACGAAAAGATCATTG

GCGGAAAGTACATGGGCGAGCTGGTACGACTTGTGCTGCTCAAGCTGGTAGAGGAGAATCTTCTGTTCCACGGAGAGGCCTCAGAGCAGCTGCGCACACG

TGGTGCTTTTGAGACCCGTTTTGTGTCGCAGGTGGAGAG CGACTCTGGGGACCGAAGGCAGATCCTTAACATCCTGAGCACTCTGGGCCTTCGACCCTC

TGTCGCCGACTGCGACATTGTGCGCCGTGCCTGTGAAAGCGTGTCCACTCGCGCCGCCCACATGTGCTCAGCAGGACTAGCGGGGGTCATAAATCGCATG

CGCGAAAGCCGCAGTGAGGACGTGATGCGCATCACGGTGGGCGTGGATGGCTCCGTGTACAAGCTGCACCCGAG CTTCAAGGAGCGGTTTCACGCCAGT

GTGCGCAGGCTGACACCCAACTGCGAAATCACCTTCATTGAATCAGAGGAGGGCAGCGGCAGGGGAGCCGCACTGGTCTCTGCGGTGGCCTGCAAGAAGG

CTTGCATGCTGGGCCAGTGAAATCCAG GAGATGCCAGAGGATAGAGGCCCAGAGTCCTTGCTCTAGGGGACCTGAAGGGGAGCGCCTCACTCTGCACTG

TTAGCAGGATGGCAGCTTCAACACTCACATCAGTGATCCGGGAAGAGAAGCAAGCCACCCACAGCATCTCTCCAGGAAACCACCCAGGTCCCTCTGTCCC

TCATCCCTGTCAGGTTTCCCAGATGCCATGCCGCCCTCTCCACACCAGCTTGGAACCATGGGGGAGTTTTTAATTAAATATTTAAAACTACTT
Translation
MLDDRARMEATKKEK - UNI32665 - VEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPTYVRSTPEGSE EVGDFLSLDLGGTNF

RVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAEM LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDK GILLNWTKGFKASGAEGNNIV

GLLRDAIKRRG DFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVG GTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDE

SSVNPGQQL LYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES SDSGDRRQILNILSTLGLRPSVADCDIVRRACESVS

TRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPS SFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ 
Transcript ENSMUST00000102920
Sequence
ATGCTGGATGACAGAGCCAGGATGGAGGCCACCAAGAAGGAAAAG - UNI32665 - GTAGAGCAGATCCTGGCAGAGTTCCAGCTGCAGGAGGAAGA

CCTGAAGAAGGTGATGAGCCGGATGCAGAAGGAGATGGACCGTGGCCTGAAGCTGGAGACCCATCAGGAGGCCAGTGTAAAGATGTTGCCCACCTACGTG

CGTTCCACCCCAGAAGGCTCAG AAGTTGGAGACTTTCTCTCCTTAGACCTGGGAGGAACCAACTTCAGGGTGATGCTGGTGAAAGTGGGGGAGGGGGAG

GCAGGACAGTGGAGCGTGAAGACGAAACACCAGATGTATTCCATCCCCGAGGACGCCATGACGGGCACTGCGGAGATG CTCTTTGACTACATCTCTGAG

TGCATCTCTGACTTCCTGGACAAGCATCAGATGAAACACAAGAAACTACCCCTGGGCTTCACCTTCTCCTTCCCTGTAAGGCACGAAGACATAGACAAG 

GGCATCCTGCTCAACTGGACCAAGGGCTTCAAGGCCTCCGGAGCAGAAGGGAACAACATCGTGGGACTTCTCCGAGATGCTATCAAGAGGAGAGGG GAC

TTTGAGATGGATGTGGTGGCAATGGTGAATGACACGGTGGCCACAATGATCTCCTGCTACTATGAAGACCGCCAATGTGAGGTCGGCATGATTGTGG GC

ACCGGCTGCAACGCCTGCTACATGGAGGAGATGCAGAATGTGGAGCTGGTGGAAGGCGATGAGGGGCGCATGTGTGTCAACACAGAGTGGGGCGCCTTCG

GGAACTCCGGTGAGCTGGACGAGTTCCTCCTGGAGTACGACCGGATGGTGGATGAGAGCTCAGTGAACCCCGGTCAGCAGCT GTACGAAAAGATCATTG

GCGGAAAGTACATGGGCGAGCTGGTACGACTTGTGCTGCTCAAGCTGGTAGAGGAGAATCTTCTGTTCCACGGAGAGGCCTCAGAGCAGCTGCGCACACG

TGGTGCTTTTGAGACCCGTTTTGTGTCGCAGGTGGAGAG CGACTCTGGGGACCGAAGGCAGATCCTTAACATCCTGAGCACTCTGGGCCTTCGACCCTC

TGTCGCCGACTGCGACATTGTGCGCCGTGCCTGTGAAAGCGTGTCCACTCGCGCCGCCCACATGTGCTCAGCAGGACTAGCGGGGGTCATAAATCGCATG

CGCGAAAGCCGCAGTGAGGACGTGATGCGCATCACGGTGGGCGTGGATGGCTCCGTGTACAAGCTGCACCCGAG CTTCAAGGAGCGGTTTCACGCCAGT

GTGCGCAGGCTGACACCCAACTGCGAAATCACCTTCATTGAATCAGAGGAGGGCAGCGGCAGGGGAGCCGCACTGGTCTCTGCGGTGGCCTGCAAGAAGG

CTTGCATGCTGGGCCAGTGAAATCCAGGCAAGGACAGGGACCTGGGTTCCACGGGGACTCCACACCCCACAAATGCTCCCAGTCCACTAGGGCAGGAGAC

CTATTCTGCTGCTACCCCTGGAAAATGGGGAGAGGCCCCTGCAAGCCAAGTCAGCCAGTGAGACAGCCCTAGGGCTCTCAGCCTGGGGCAAGGGGCAAGA

GGATCAGCGGCACCAAAAGCCTTTCTTGCTAGAATCAACTACAGAGAAAGGTGAAGCACACTCAGGTCTTGCTCTTTCAGCTTCTGGCCTCCCACAGCTG

TGGGTCTGGCCTCCCAAGGGAGTGCCTCCTGGACTTGCAATGGCCTGGCTTCCCTGGGAACACATCTCCATGGGGAGGTAGCTTCAGCAGCTTGGCCAGA

CCAGACCTGGGCCCCCAGAAGAGTAAGGGCTGCCCAGACCTGGCTGTTTTCTTGCCTGTGGCTGAAGAGGCTGCAAAACCATGGGAGACCGACTATCTAG

CTACATGGAGGGGACTTTCCAGGCCACAAACATTCCAGAGACAGTCTCCTTCATATACCTCCACCCCTGAGTGGCTTACAGTTCTGGGATGAACCCTCCT

AGGAGATGCCAGAGGATAGAGGCCCAGAGTCCTTGCTCTAGGGGACCTGAAGGGGAGCGCCTCACTCTGCACTGTTAGCAGGATGGCAGCTTCAACACTC

ACATCAGTGATCCGGGAAGAGAAGCAAGCCACCCACAGCATCTCTCCAGGAAACCACCCAGGTCCCTCTGTCCCTCATCCCTGTCAGGTTTCCCAGATGC

CATGCCGCCCTCTCCACACCAGCTTGGAACCATGGGGGAGTTTTTAATTAAATATTTAAAACTACTT
Translation
MLDDRARMEATKKEK - UNI32665 - VEQILAEFQLQEEDLKKVMSRMQKEMDRGLKLETHQEASVKMLPTYVRSTPEGSE EVGDFLSLDLGGTNF

RVMLVKVGEGEAGQWSVKTKHQMYSIPEDAMTGTAEM LFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDK GILLNWTKGFKASGAEGNNIV

GLLRDAIKRRG DFEMDVVAMVNDTVATMISCYYEDRQCEVGMIVG GTGCNACYMEEMQNVELVEGDEGRMCVNTEWGAFGNSGELDEFLLEYDRMVDE

SSVNPGQQL LYEKIIGGKYMGELVRLVLLKLVEENLLFHGEASEQLRTRGAFETRFVSQVES SDSGDRRQILNILSTLGLRPSVADCDIVRRACESVS

TRAAHMCSAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPS SFKERFHASVRRLTPNCEITFIESEEGSGRGAALVSAVACKKACMLGQ

For any suggestions or comments, please send an email to unitrap@crg.es