Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041837 (Pdcd7)
Chromosomal location
Chr 9: 65193875 - 65207450 (+)
Description
programmed cell death 7 Gene [Source:MGI Symbol;Acc:MGI:1859170]
RefSeq_dna
NM_016688 
RefSeq_peptide
NP_057897.2 
UniGene
Mm.29193 
MGI
MGI:1859170 
Uniprot/SWISSPROT
Q9WTY1 
Uniprot/SPTREMBL
Q3U2X6 
Human Ortholog
ENSG00000090470 (PDCD7)
Omim not available
UniTrap UNI22010
Vector Insertion
Chr 9: 65204613 - 65206400
Public Clones not available
Private Clones OST311502 (lexicon) OST60634 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048184
Sequence
GTCACTTCCTCCTGGAACCCGGATAAAGAAGTTCCCAGATTACTGTCACTGCTCCCAACCGCTGCACTACAGACATGGCTCTGCCACCTTTTTTCGCCCA

GAGCCGTCAGGGACCTCCCCCTCCGCAGCCACCGCCTTCCGCTCCATTCGGCTGTCCGCCCCCGCCGCTGCCCTCTCCGGCTTTCCCGCCGCCCCTTCCC

CAGCGACCCGGCCCCTTCCCGGGGGCTTCCGCCCCCTTCCTCCAGCCTCCGCTGGCCCTGCAGCCCCGCGCGCCAGCCGAGGCCTCCCGCGGCGGTGGCG

GTGGCGGCGCCTTCTTCCCGGTGCCACCCCCACCGCTGCCGCCGCCGCCGCCGCAGTGCCGGCCCTTCCCGGGGCCCGACGCCGTCGAGCGTCCACGGCC

ACCGCCTCCAGGTCCCGGGCCGCCCTGGAGCCCGCGCTGGGCGGAGGCGCCGCCGCCGCCCGACGTGCTCGGAGACGCGGCCCTGCAGCGCCTGCGTGAT

CGGCAGTGGCTGGAGGCGGTGTTCGGGAACCCCCGGCGGCCCGGTGGCCTCCGGACCCCGCGCACACCCGCCGGGCCCAGCCTGGGTGAAGTCCGCGCGC

GGTTGCGTTCCGCTTTGCGTTTGGTGCGGCGGCTACGCAGCTTGGGGCAGTCCCTGCGCGAGGCTGAGGCCGACGGAGCAGCCTGGGCCTCCCTGCACGC

TCAGGCGGCGCCACTACGAGCGGAGCTAGCGGAGCGGCTGCAGCCGCTGGCCCAGGCCGCCTATGTGGGCGAGGCGCGACGGAGGCTGGAGAGGGTCCGG

CGCCGCCGGCTGCGGCTTCGTGAGAGGGCCCGGGATCGGGAGGCTGAGCGGGAGGCGGAGGCCGCGCAGGCCACGGAACGGGAGCAGGAGATTGACCGCT

GGAGGGTGAAGTGCGTGCAGGAAGTGGAGGAAAAGAAGCGG GAGCAGGAACTCAAAGCAGCTGCTGATGGGGTCTTAGCTGAAGTAAGGAAAAAGCAAT

CAGACACCAAAAGGATGGTGGACATTCTGCGTGCTTTAGAGAAGCTGAGGAAACTGAGGAAAGAAGCTGCAGCAAGGAAAG GGGTCTGTCCTCCTGCTT

CAGCGGATGAGACTTTCGAGCACCATCTTCAGCGGCTGAGAAAGCTCATTAAAAAGCGCTCTGAACTGTATGAAGCTGAAGAGAGAGCCCTCCGAGTTAT

GCTAGAAGGAGAGCAGGAGGAGGAGAGGAGACGAGAACTGGAAAAGAAACAGAGAAAAGAGAAAGAGAAACTTCTACTACAGAAACGGGAAATTGAGTCC

AAGTTATTCGGGGATCCAG ATGAGTTCCCACTTGCTCACCTCCTGCAGCCATTCCGGCAGTATTACCTCCAGGCTGAGCACTCCTTGCCCGCGCTCATT

CAGATAAG - UNI22010 - GCATGATTGGGATCAGTACCTGGTACCATCTGATCATCCGAAAGGCAACTCGGTTCCCCAAGGATGGGTCCTTCCTCC

GCTCCCCAGCAACGACATCTGGGCAACGGCCATTCAGCTGCATTAAGATGCTCCAGGAGTGTGGTCCAGCTGGCAAGCACTGCAGCTCTAGATATTAGAG

ATGCGGTTGTCTCACGCTCTAGTCTTCTACACAACTTAACTCTGTGTGGCATTGTCCTAGCTGGAAAGCCTTTTTCTTTTGTTCTCTGCCCTAGGCAGGG

GTACCTCTGGAGCCAGAGGTTCATAAGGTTCTTCTGGAAAGGATCTAGATGAACTGAGGTTATTAGCATGGGCTGTAGCCTTGGCTCTCTAAATCTGCCT

CTGTTTTGAGAGGCTTGGTTCAATGTGGCCTGCTCATTTGTTCCAGGTTTGTTATATATTGGTGGGTAAGAACAGGCAGCACACTTGGCTACTGCTTGAA

GGTGTTCACTGAGTAGAGTTAGCAGCTACTGCTCCTTATCTTCCCATACCACCTGCCCTCCAGCTCCCAGGAGCACCTACAGTTTCCAGTTTCAGTGCAG

TGTGGGAGGCTGCTACTGAAGATGATGGGGCAGTGGCTGCCAGGATCACTGATGGCTTAGAACTGTTGTCCTGTGGAGAGCTTAGAAAACTTGAAGAGTT

AGCAGAGCCAGGGTGGCTTGTGCTCTGACAGACAGTGCCTGTTTTCCTCATGAAAGTGCCAGTGCAAGAGTTGTGAGGGAACTAGTTGTGTGGGGCCTCC

AAGAATAGAAACTTATTTCCCTGTGGGACTGTAATCTCAGTCACATGGTAGGGGCTGGATAGCTCAAGCTTCTAAAAACATCCATGTCATAAAAGCCGGG

AAAAGAGCAAATATGAAAGATAAATTTTATTTTTATATTCATTAATAAGTGCTGTTGTATTTGGACATGATCAGTCATATGACATGTTATGGTTTTTGTT

TTGCCTTATTCTGGGTTTTGTTATTTAATTTCCTAAAAGCTGAATAAATACCATTTTTGCTTTTTTGTTTGA
Translation
MALPPFFAQSRQGPPPPQPPPSAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRAPAEASRGGGGGGAFFPVPPPPLPPPPPQCRPFPG

PDAVERPRPPPPGPGPPWSPRWAEAPPPPDVLGDAALQRLRDRQWLEAVFGNPRRPGGLRTPRTPAGPSLGEVRARLRSALRLVRRLRSLGQSLREAEAD

GAAWASLHAQAAPLRAELAERLQPLAQAAYVGEARRRLERVRRRRLRLRERARDREAEREAEAAQATEREQEIDRWRVKCVQEVEEKKR EQELKAAADG

VLAEVRKKQSDTKRMVDILRALEKLRKLRKEAAARKG GVCPPASADETFEHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERRRELEKKQRKEKE

KLLLQKREIESKLFGDPD DEFPLAHLLQPFRQYYLQAEHSLPALIQIR - UNI22010 - RHDWDQYLVPSDHPKGNSVPQGWVLPPLPSNDIWATA

IQLH

For any suggestions or comments, please send an email to unitrap@crg.es