Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041921 (Metapl1)
Chromosomal location
Chr 2: 71291395 - 71363223 (+)
Description
methionine aminopeptidase-like 1 Gene [Source:MGI (curated);Acc:Metapl1-001]
RefSeq_dna
NM_025633 
RefSeq_peptide
NP_079909.1 
MGI
MGI:1913809 
Uniprot/SWISSPROT
Q9CPW9 
Uniprot/SPTREMBL
Q9CRV0 Q8C933 
Human Ortholog
ENSG00000172878 (AC015976.3)
Omim not available
UniTrap UNI5160
Vector Insertion
Chr 2: 71291394 - 71291456
Public Clones YHD056 (baygenomics) YTC206 (baygenomics) XG804 (baygenomics) CSJ181 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30045
Vector Insertion
Chr 2: 71291456 - 71344841
Public Clones D139E05 (ggtc) D108B09 (ggtc) IST11965E10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17755
Vector Insertion
Chr 2: 71344841 - 71345000
Public Clones not available
Private Clones OST436924 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037210
Sequence
GGCCACGTGACCGGAGCCAACATGGCGGCGCCCATCGGCGTCCCCCTGCTCGTCCGTGGAG - UNI5160 - - UNI17755 - - UNI30045 - 

GTTGTCAGAGAATTCTGTCTTCGCCACTCAATCATATCTACTTACACAAGCGGTCAGGCAGTCAACAAAGAAGACATTTCTTTTTCTGGAGACAAAGGGA

TATCTCCCACAGTGTGGTTTCACCGGCTGCCGTCTCTCCCGCACATCCTGTCCCCAAG - UNI17755 - CGCATAAAGAAGCCAGACTACGTGACGA

CAGGCATTGTGCCGGACTGGGGAGACAGCATAGAAGTGAAGGATGAAGATCAGATTCAAGGGCTTCGTGAGGCTTGTCGGCTGGCGAGACACGTCCTCCT

CCTGGCTGGGAAGAGTTTAAAG GTTGACATGACAACTGAAGAGATAGATGCGCTTGTTCATTGGGAAATCATCAGGCATGACGCATATCCCTCACCTCT

GGGCTATGGACGCTTTCCAAAATCTGTTTGCACCTCTGTAAACAACGTGCTCTGTCATGGCATTCCTGACAG CCGACCTCTTCAGGATGGAGATATTAT

CAACATTGATGTCACG GTCTATTACAATGGCTACCATGGAGACACCTCTGAAACCTTTCTGGTGGGCAATGTGGATGAAAGTGGTAAAAAGTTAGTGGA

GGTTGCCAGGAGGTGTAGAGATGAAGCGATTGCAGCCTGCAGAGCTGGGGCCCCCTTCTCTGTAATTGGAAACACAATCAG CCGCATAACTCATCAGAA

TGGTTTGCAAGTCTGTCCACATTTTGTGGGACATGGGATAGGATCATACTTTCATGGACACCCAGAAATTTGGCATCATG CAAATGACAATGATCTGCC

CATGGAGGAGGGCATGGCTTTCACCATAG AGCCAATCATCACTGAAGGTTCCCCAGAATTTAAAGTCCTTGAGGACGCATGGACCGTGGTCTCCCTAGA

CAACCAAAG GTCTGCGCAGTTCGAGCACACAGTCCTCATCACGCCAAGGGGAGTGGAGATACTGACCAAACTGCCACAAGAAGCCTGAGAATCGGCCAG

AAGGCCACCAAGACCCAGAGGACTGAGAAAGCATCCCCAGGCCACACACAAGTCTGCAGTGTCTAGGAGAAAACGCAGAGAGGACGGGCTCTGGGGACTC

AGGTCCAACAGGACAGCCCTTGTGGCTAGAAAAACAAACCTCCCTTCCTGGGCAGGTGGTTCGCCCTTTTCCTGTCCATATTCCGCCCAAGTTT
Translation
MAAPIGVPLLVRGG - UNI5160 - - UNI17755 - - UNI30045 - GCQRILSSPLNHIYLHKRSGSQQRRHFFFWRQRDISHSVVSPAAVSP

AHPVPK - UNI17755 - RIKKPDYVTTGIVPDWGDSIEVKDEDQIQGLREACRLARHVLLLAGKSLK VDMTTEEIDALVHWEIIRHDAYPSPLGYG

RFPKSVCTSVNNVLCHGIPDS SRPLQDGDIINIDVT VYYNGYHGDTSETFLVGNVDESGKKLVEVARRCRDEAIAACRAGAPFSVIGNTIS SRITHQ

NGLQVCPHFVGHGIGSYFHGHPEIWHHA ANDNDLPMEEGMAFTIE EPIITEGSPEFKVLEDAWTVVSLDNQR RSAQFEHTVLITPRGVEILTKLPQE

A
Transcript ENSMUST00000112116
Sequence
GGCCACGTGACCGGAGCCAACATGGCGGCGCCCATCGGCGTCCCCCTGCTCGTCCGTGGAG - UNI5160 - - UNI17755 - - UNI30045 - 

GTTGTCAGAGAATTCTGTCTTCGCCACTCAATCATATCTACTTACACAAGCGGTCAGGCAGTCAACAAAGAAGACATTTCTTTTTCTGGAGACAAAGGGA

TATCTCCCACAGTGTGGTTTCACCGGCTGCCGTCTCTCCCGCACATCCTGTCCCCAAG - UNI17755 - CGCATAAAGAAGCCAGACTACGTGACGA

CAGGCATTGTGCCGGACTGGGGAGACAGCATAGAAGTGAAGGATGAAGATCAGATTCAAGGGCTTCGTGAGGCTTGTCGGCTGGCGAGACACGTCCTCCT

CCTGGCTGGGAAGAGTTTAAAG GTTGACATGACAACTGAAGAGATAGATGCGCTTGTTCATTGGGAAATCATCAGGCATGACGCATATCCCTCACCTCT

GGGCTATGGACGCTTTCCAAAATCTGTTTGCACCTCTGTAAACAACGTGCTCTGTCATGGCATTCCTGACAG CCGACCTCTTCAGGATGGAGATATTAT

CAACATTGATGTCACG AAGCCAGCGATCTCTGTGAAGCCTTTTGGTGTGGTCTTCTTGCTGCCCAGGAGAGCAAGCTCTTCATTGTGTGACAGTGTATG

GGTGTGA
Translation
MAAPIGVPLLVRGG - UNI5160 - - UNI17755 - - UNI30045 - GCQRILSSPLNHIYLHKRSGSQQRRHFFFWRQRDISHSVVSPAAVSP

AHPVPK - UNI17755 - RIKKPDYVTTGIVPDWGDSIEVKDEDQIQGLREACRLARHVLLLAGKSLK VDMTTEEIDALVHWEIIRHDAYPSPLGYG

RFPKSVCTSVNNVLCHGIPDS SRPLQDGDIINIDVT KPAISVKPFGVVFLLPRRASSSLCDSVWV
Transcript ENSMUST00000037223
Sequence
GGCCACGTGACCGGAGCCAACATGGCGGCGCCCATCGGCGTCCCCCTGCTCGTCCGTGGAG - UNI5160 - - UNI17755 - - UNI30045 - 

GTTGTCAGAGAATTCTGTCTTCGCCACTCAATCATATCTACTTACACAAGCGGTCAGGCAGTCAACAAAGAAGACATTTCTTTTTCTGGAGACAAAGGGA

TATCTCCCACAGTGTGGTTTCACCGGCTGCCGTCTCTCCCGCACATCCTGTCCCCAAG - UNI17755 - CGCATAAAGAAGCCAGACTACGTGACGA

CAGGCATTGTGCCGGACTGGGGAGACAGCATAGAAGTGAAGGATGAAGATCAGATTCAAGGGCTTCGTGAGGCTTGTCGGCTGGCGAGACACGTCCTCCT

CCTGGCTGGGAAGAGTTTAAAG GTTGACATGACAACTGAAGAGATAGATGCGCTTGTTCATTGGGAAATCATCAGGCATGACGCATATCCCTCACCTCT

GGGCTATGGACGCTTTCCAAAATCTGTTTGCACCTCTGTAAACAACGTGCTCTGTCATGGCATTCCTGACAG CCGACCTCTTCAGGATGGAGATATTAT

CAACATTGATGTCACG GTCTATTACAATGGCTACCATGGAGACACCTCTGAAACCTTTCTGGTGGGCAATGTGGATGAAAGTGGTAAAAAGTTAGTGGA

GGTTGCCAGGAGGTGTAGAGATGAAGCGATTGCAGCCTGCAGAGCTGGGGCCCCCTTCTCTGTAATTGGAAACACAATCAG TCGAAGGGGGCAGAGAAC

ACTGGATTCTTATTCAGGCATTCTGTGGAGTTCTGCATTCATGGCTGTGTCTAAAGGGCATGTCAGCCTTTGA
Translation
 - UNI5160 - - UNI17755 - - UNI30045 -  - UNI17755 -  MTTEEIDALVHWEIIRHDAYPSPLGYGRFPKSVCTSVNNVLCHGIP

DS SRPLQDGDIINIDVT VYYNGYHGDTSETFLVGNVDESGKKLVEVARRCRDEAIAACRAGAPFSVIGNTIS SRRGQRTLDSYSGILWSSAFMAVSK

GHVSL

For any suggestions or comments, please send an email to unitrap@crg.es