Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041974 (2310008H04Rik)
Chromosomal location
Chr 16: 15889320 - 16146944 (-)
Description
RIKEN cDNA 2310008H04 gene Gene [Source:MGI Symbol;Acc:MGI:1924834]
RefSeq_dna
NM_146068 
RefSeq_peptide
NP_666180.2 
MGI
MGI:1924834 
Uniprot/SWISSPROT
Q8BGX7 
Uniprot/SPTREMBL
Q3TLL0 
Human Ortholog
ENSG00000164808 (KIAA0146)
Omim not available
UniTrap UNI21888
Vector Insertion
Chr 16: 16140957 - 16146837
Public Clones IST14578B1 (tigm)
Private Clones OST314690 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27041
Vector Insertion
Chr 16: 16140166 - 16140800
Public Clones not available
Private Clones OST77063 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4069
Vector Insertion
Chr 16: 16073314 - 16114919
Public Clones AP0886 (sanger) (sanger) RRQ067 (baygenomics) D073G10 (ggtc) E049H07 (ggtc)
D092A04 (ggtc) M120E05 (ggtc) 3SE167B04 (ggtc) IST12893H12 (tigm) IST11513C2 (tigm)
IST10260A4 (tigm) IST14724H6 (tigm) IST14074F6 (tigm) IST14774H6 (tigm)
IST15063F3 (tigm) IST10188E10 (tigm) IST13090B3 (tigm) IST10221B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14480
Vector Insertion
Chr 16: 16053358 - 16073314
Public Clones (cmhd) FHCRC-GT-S11-11B1 (fhcrc)
Private Clones OST459788 (lexicon) OST430928 (lexicon) OST390476 (lexicon) OST341624 (lexicon)
OST282918 (lexicon) OST202870 (lexicon) OST127571 (lexicon) OST38903 (lexicon)
OST31030 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28475
Vector Insertion
Chr 16: 16048198 - 16053358
Public Clones not available
Private Clones OST30175 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24051
Vector Insertion
Chr 16: 16037803 - 16048096
Public Clones not available
Private Clones OST236577 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31575
Vector Insertion
Chr 16: 15968620 - 16037803
Public Clones IST13795F1 (tigm) IST12053F12 (tigm) IST13978F2 (tigm) IST14405A1 (tigm)
IST14312E6 (tigm) IST12267F3 (tigm) IST10513B2 (tigm) IST13136H10 (tigm)
IST13248H7 (tigm) IST12654G1 (tigm) IST12058F7 (tigm) IST12314B9 (tigm)
IST11814E7 (tigm) IST14379C6 (tigm) IST14854B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17647
Vector Insertion
Chr 16: 15895290 - 15895618
Public Clones not available
Private Clones OST439019 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29305
Vector Insertion
Chr 16: 15889879 - 15895235
Public Clones PSTVUpb21b9 (vanderbilt)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115757
Sequence
ATGATTGCAAGTGTAGCTCCTCACTGTCCTTCAGAAGTTCCCCCAGGTCTCCTAAAACCTGAGGAAAAG - UNI14480 - CCAATTTCTACAGAAAT

TTTGGAGTATTCATCAGATAGTGAAAAAGAAGAAGACCCAGAACATTCCCTGTTCATTGATTCAGAATCCCCTCACAAATACCAGGCGGATTTTAAATCT

GATGCAAGATGGTGTTTGGTTAGTCAGACTGACTCAGAAGCAAATTCAGCTGAGCCTACATTGACACCCCAGAAATATACGGTCAAGTTTCCGAAGACTC

CAGAATATTCAGTAACAAAGAAGAAGCTTTTAAG - UNI14480 - - UNI28475 - GGGCGGGCTAGCAGAAAGACTCCAAGAACTGCAGAATCG

AAAGAGATCTGCCATTTCTTTGTGGAGACATCGATGTGTTTCTTACCAAATGACACCATTAG - UNI24051 - - UNI31575 - GCAGAAAATCT

GGTGTATTAACTGTGAAAATTCTAGAACTGCATGAGGAATGCAGCATGCAAGTTGCAGTATGTGAGCAGTTAGCAGGGCCTCCAATCACCAGCCCTCCCG

GAGGACTAGCTCCTAGACCAGGAGCCTACCTGAAGGTACTCTTCACCAGAGAGACTGCAGACCACTTGATGGGGCATCCCCAGGACATCATTTACATCTT

CCCTCCTTG - UNI31575 - GCAAAAACTTCTTATCCCAAATGGAAGTTGCTCCATTATTCTGAATACTTATTTTTGTCAGAAAGCTATTGCAAAAG

AAACAGTGCGCGAAGACCTATACAGTCCGGACATATCTCTTTCAAGGAGAAATATAACTTTGGCCCAGACATTTAGAATTAAGGACATAACAGACAATTC

ATCCATCAATCAG - UNI31575 - ACTACATATGATAGCCTGGCCACCCCTGGCACAGGCTGGACCCACGGACATGAGAAGGCAGAGCAACATCTTA

TAGTTGCTGCTCCCCTGAGGAATTCTCTTCTGGACATTGTGGAAAGCCAAAGAGCTGGCCTATGGTCTGGAGTCAGGGTCCAAGTAGTAGTGCAGAGGGT

GTACTCTCTTCTCAGCAGAGATGGTGCCAGGAGCCAGCAAGGGCACACAGTGGGACATGCAGATGCCTCTGGAGCATG GTCCTGCCTTCTAGTGCAGGA

TGCCTGTGGCATGTTCGGGGAAGTGTTCTTGAACAGCACCCTCTGGAAGAGCAGACAGTTAGAAGGGAAGTCCTGCAGCATGTCGGGAGTGAAGGTTCTA

CAGAAAGCTACAAGAGGAAG GACACCAGGGCTCTTCAGTTTAATTGACAGTTTGTGGCCCCCAGTGATATCTCTGACTGAGCCTTCCTGTGGCCAGCCC

AGTGGAGAG ACAAAGACTTATCTGCCTCCTCCTATCTTCTGTTATATCTTCTCTGCACATCCAACACTGGGACAAATTGATGCAATTGAAGACCACATT

TCCAAGCTTTACCAGCCTCCAGTTGTCCGCTGCTTAAAAGAAATCCTCCAG ACTAATGAGTGCAGTACACGTTGCAGCTTCTATGCCAGAGTGATTTAT

CAAAAACCACAG CTAAAGAATCTTTTGGCGCAAAAGGAAATCTGGCTGCTGGTGACTGACATCACTCTGCAAACACAGGATGAAAGGGACCACTCTCTT

CCCAAAACCCTGCCTGTCTATATAGCCCCCTCGTGTGTGCTGGGCCCAGAGGTTGTAGAAGAACTTGCCTTGCTGGTGTCTTATAACTTACTCTTCAGGG

ACGCTTTTAAGGACAACG GTCAGATTGTTTGTATTGAACGGACAGTCATCCTACCCCAGAAACCTCTCTTGTGTGTACCTTCTGCTTCCTGTGACTTGC

CCAGCCCAGTGACACTGGATGAACTGAGTGCCCTCACACCTGTCAACTCCATTTGCAGTGTGCAAG GTACTGTGGTTGATGTAGATGAGAGCACTGCTT

TCTCGTGGCCTGTGTGTGACCGGTGTGGCAATGGGAGACTGGAACAGAAGCCAGAAGATGG AGGCACCTTCTCCTGTGGGGACTGTTCCCAACTGGTCC

TGTCACCTCTTCAAGAGAGGCACCTGCATGTCTTTCTGGACTGTCCCACGAGACCTGAGAGTACTGTGAAGGTCAAG - UNI17647 - CTATTGGAG

AGCAGTATTTCTTTACTTCTGATGTCTGCTGCCTCTGAGGATGGG - UNI29305 - AGTTATGAAGTGGAGAGCGTCCTTGGGAAGGAGATGGGACC

TTTACTCTGCTTTGTCCAGTCCATCACTACACAGCAGAGCAGCTGTGTCGTCACCCTGGAAGAGATTGAGCTGCTGAGTACAGAGGGAGCCACTGCTGCT

CAGCCTCCTCCCTGACATCTGTGCGCTTGGCAAGGGGCTGTGTGTTAACTCAGTGTTTCTGTTTTTAAATTTAGTGGGTTTCTTTTCTTTCTTTTTTCTG

GTAAAGAGATTAATAGGATAGTTTTAAATTAAAAATCAAGATACCTCTAATACACATTTTTTTAAACTTTACCTTCCTACAAGTTTGATAACATGTTTCT

TTGAGTGTTTCTCATGTCTTCTGTGTCTTCATTTTGCAGCTACTTGGGCTTAGGAAATGTGCTTTGTTGTAGCTTTAAAGTAGTTACAATTTATCAATAT

TATATATGTTTTTTCTTTGCAGTATCTAATATTCTCTGCTAGATTGTTCTGTAAAGCTTCAGCCAGTATCTCATATTGAAATATTACTGTTCTGTTACAA

TAAATAAATGTCCAACCT
Translation
MIASVAPHCPSEVPPGLLKPEEK - UNI14480 - PISTEILEYSSDSEKEEDPEHSLFIDSESPHKYQADFKSDARWCLVSQTDSEANSAEPTLTPQ

KYTVKFPKTPEYSVTKKKLLR - UNI14480 - - UNI28475 - RGGLAERLQELQNRKRSAISLWRHRCVSYQMTPLG - UNI24051 - - U

NI31575 - GRKSGVLTVKILELHEECSMQVAVCEQLAGPPITSPPGGLAPRPGAYLKVLFTRETADHLMGHPQDIIYIFPPW - UNI31575 - WQ

KLLIPNGSCSIILNTYFCQKAIAKETVREDLYSPDISLSRRNITLAQTFRIKDITDNSSINQ - UNI31575 - TTYDSLATPGTGWTHGHEKAEQHL

IVAAPLRNSLLDIVESQRAGLWSGVRVQVVVQRVYSLLSRDGARSQQGHTVGHADASGAW WSCLLVQDACGMFGEVFLNSTLWKSRQLEGKSCSMSGVK

VLQKATRGR RTPGLFSLIDSLWPPVISLTEPSCGQPSGE TKTYLPPPIFCYIFSAHPTLGQIDAIEDHISKLYQPPVVRCLKEILQ TNECSTRCSFY

ARVIYQKPQ LKNLLAQKEIWLLVTDITLQTQDERDHSLPKTLPVYIAPSCVLGPEVVEELALLVSYNLLFRDAFKDNG GQIVCIERTVILPQKPLLCV

PSASCDLPSPVTLDELSALTPVNSICSVQG GTVVDVDESTAFSWPVCDRCGNGRLEQKPEDG GGTFSCGDCSQLVLSPLQERHLHVFLDCPTRPESTV

KVK - UNI17647 - LLESSISLLLMSAASEDG - UNI29305 - SYEVESVLGKEMGPLLCFVQSITTQQSSCVVTLEEIELLSTEGATAAQPPP

Transcript ENSMUST00000040248
Sequence
GAGGGAAGGGGGCGGGGCGCGTGATGGGCGGCTTCCGGATGGGGCGGCGAGCAGGAAGACTGTGCACGTAGGAGATGTCTGGAGCCCGCCGCCCCGGCAC

GTCCAAG - UNI21888 - AGGAAAAGGAATTGGCATATAGAACACCCATCCTTTCGAGAAGAGAGGTCACAGCAGTTGAGACGGGGAAATTTCAAGA

CAGTGGAAGCAGCTGACTCTCTCTCTAAAGCATGGCTCAAGTGTGGAGAAGGATTTCAGGACACCTCTGAGATCCTG - UNI27041 - TCATTAGCA

AGTGAAAAGACAGGTATTACTGAAAAGCACCTGGAATTATCTCCAAAACCAAAGACAG AAACTACAAGTAAGAATGCTAGTGAGCTTCCAAATATAATA

TGGAGTTCCAGTGAAAGTGATTTCTCCGATGAAGATAAGACACTTCCTGCATTACAGAGAGATGGTAGGCATGGCCCTAGAGCCGACAGGCTTGGTGACA

GGACTATCTCATGTCCCGAAGACGAAGACATTGAAG ATGAATTACAGGTTATTGACTGGGAGGTTAACAGTGACAAAGAAGATCCTGGTGGGCCTAGTG

AGTGTGAAGATGATAAGGGTACCCTGGACATCTCAGATTGTGATTCCTGTGCAAGTCTGACAAGTGATGACAGGCTATGTGAGCCTTCTGAG - UNI40

69 - - UNI14480 - CCAATTTCTACAGAAATTTTGGAGTATTCATCAGATAGTGAAAAAGAAGAAGACCCAGAACATTCCCTGTTCATTGATTCAG

AATCCCCTCACAAATACCAGGCGGATTTTAAATCTGATGCAAGATGGTGTTTGGTTAGTCAGACTGACTCAGAAGCAAATTCAGCTGAGCCTACATTGAC

ACCCCAGAAATATACGGTCAAGTTTCCGAAGACTCCAGAATATTCAGTAACAAAGAAGAAGCTTTTAAG - UNI14480 - - UNI28475 - GGGC

GGGCTAGCAGAAAGACTCCAAGAACTGCAGAATCGAAAGAGATCTGCCATTTCTTTGTGGAGACATCGATGTGTTTCTTACCAAATGACACCATTAG - 

UNI24051 - - UNI31575 - GCAGAAAATCTGGTGTATTAACTGTGAAAATTCTAGAACTGCATGAGGAATGCAGCATGCAAGTTGCAGTATGTGA

GCAGTTAGCAGGGCCTCCAATCACCAGCCCTCCCGGAGGACTAGCTCCTAGACCAGGAGCCTACCTGAAGGTACTCTTCACCAGAGAGACTGCAGACCAC

TTGATGGGGCATCCCCAGGACATCATTTACATCTTCCCTCCTTG - UNI31575 - GCAAAAACTTCTTATCCCAAATGGAAGTTGCTCCATTATTCT

GAATACTTATTTTTGTCAGAAAGCTATTGCAAAAGAAACAGTGCGCGAAGACCTATACAGTCCGGACATATCTCTTTCAAGGAGAAATATAACTTTGGCC

CAGACATTTAGAATTAAGGACATAACAGACAATTCATCCATCAATCAG - UNI31575 - ACTACATATGATAGCCTGGCCACCCCTGGCACAGGCTG

GACCCACGGACATGAGAAGGCAGAGCAACATCTTATAGTTGCTGCTCCCCTGAGGAATTCTCTTCTGGACATTGTGGAAAGCCAAAGAGCTGGCCTATGG

TCTGGAGTCAGGGTCCAAGTAGTAGTGCAGAGGGTGTACTCTCTTCTCAGCAGAGATGGTGCCAGGAGCCAGCAAGGGCACACAGTGGGACATGCAGATG

CCTCTGGAGCATG GTCCTGCCTTCTAGTGCAGGATGCCTGTGGCATGTTCGGGGAAGTGTTCTTGAACAGCACCCTCTGGAAGAGCAGACAGTTAGAAG

GGAAGTCCTGCAGCATGTCGGGAGTGAAGGTTCTACAGAAAGCTACAAGAGGAAG GACACCAGGGCTCTTCAGTTTAATTGACAGTTTGTGGCCCCCAG

TGATATCTCTGACTGAGCCTTCCTGTGGCCAGCCCAGTGGAGAG ACAAAGACTTATCTGCCTCCTCCTATCTTCTGTTATATCTTCTCTGCACATCCAA

CACTGGGACAAATTGATGCAATTGAAGACCACATTTCCAAGCTTTACCAGCCTCCAGTTGTCCGCTGCTTAAAAGAAATCCTCCAG ACTAATGAGTGCA

GTACACGTTGCAGCTTCTATGCCAGAGTGATTTATCAAAAACCACAG CTAAAGAATCTTTTGGCGCAAAAGGAAATCTGGCTGCTGGTGACTGACATCA

CTCTGCAAACACAGGATGAAAGGGACCACTCTCTTCCCAAAACCCTGCCTGTCTATATAGCCCCCTCGTGTGTGCTGGGCCCAGAGGTTGTAGAAGAACT

TGCCTTGCTGGTGTCTTATAACTTACTCTTCAGGGACGCTTTTAAGGACAACG GTCAGATTGTTTGTATTGAACGGACAGTCATCCTACCCCAGAAACC

TCTCTTGTGTGTACCTTCTGCTTCCTGTGACTTGCCCAGCCCAGTGACACTGGATGAACTGAGTGCCCTCACACCTGTCAACTCCATTTGCAGTGTGCAA

G GTACTGTGGTTGATGTAGATGAGAGCACTGCTTTCTCGTGGCCTGTGTGTGACCGGTGTGGCAATGGGAGACTGGAACAGAAGCCAGAAGATGG AGG

CACCTTCTCCTGTGGGGACTGTTCCCAACTGGTCCTGTCACCTCTTCAAGAGAGGCACCTGCATGTCTTTCTGGACTGTCCCACGAGACCTGAGAGTACT

GTGAAGGTCAAG - UNI17647 - CTATTGGAGAGCAGTATTTCTTTACTTCTGATGTCTGCTGCCTCTGAGGATGGG - UNI29305 - AGTTAT

GAAGTGGAGAGCGTCCTTGGGAAGGAGATGGGACCTTTACTCTGCTTTGTCCAGTCCATCACTACACAGCAGAGCAGCTGTGTCGTCACCCTGGAAGAGA

TTGAGCTGCTGAGTACAGAGGGAGCCACTGCTGCTCAGCCTCCTCCCTGACATCTGTGCGCTTGGCAAGGGGCTGTGTGTTAACTCAGTGTTTCTGTTTT

TAAATTTAGTGGGTTTCTTTTCTTTCTTTTTTCTGGTAAAGAGATTAATAGGATAGTTTTAAATTAAAAATCAAGATACCTCTAATACACATTTTTTTAA

ACTTTACCTTCCTACAAGTTTGATAACATGTTTCTTTGAGTGTTTCTCATGTCTTCTGTGTCTTCATTTTGCAGCTACTTGGGCTTAGGAAATGTGCTTT

GTTGTAGCTTTAAAGTAGTTACAATTTATCAATATTATATATGTTTTTTCTTTGCAGTATCTAATATTCTCTGCTAGATTGTTCTGTAAAGCTTCAGCCA

GTATCTCATATTGAAATATTACTGTTCTGTTACAATAAATAAATGTCCAACCT
Translation
MSGARRPGTSK - UNI21888 - RKRNWHIEHPSFREERSQQLRRGNFKTVEAADSLSKAWLKCGEGFQDTSEIL - UNI27041 - SLASEKTGI

TEKHLELSPKPKTE ETTSKNASELPNIIWSSSESDFSDEDKTLPALQRDGRHGPRADRLGDRTISCPEDEDIED DELQVIDWEVNSDKEDPGGPSECE

DDKGTLDISDCDSCASLTSDDRLCEPSE - UNI4069 - - UNI14480 - PISTEILEYSSDSEKEEDPEHSLFIDSESPHKYQADFKSDARWCLV

SQTDSEANSAEPTLTPQKYTVKFPKTPEYSVTKKKLLR - UNI14480 - - UNI28475 - RGGLAERLQELQNRKRSAISLWRHRCVSYQMTPLG

 - UNI24051 - - UNI31575 - GRKSGVLTVKILELHEECSMQVAVCEQLAGPPITSPPGGLAPRPGAYLKVLFTRETADHLMGHPQDIIYIFPP

W - UNI31575 - WQKLLIPNGSCSIILNTYFCQKAIAKETVREDLYSPDISLSRRNITLAQTFRIKDITDNSSINQ - UNI31575 - TTYDSLA

TPGTGWTHGHEKAEQHLIVAAPLRNSLLDIVESQRAGLWSGVRVQVVVQRVYSLLSRDGARSQQGHTVGHADASGAW WSCLLVQDACGMFGEVFLNSTL

WKSRQLEGKSCSMSGVKVLQKATRGR RTPGLFSLIDSLWPPVISLTEPSCGQPSGE TKTYLPPPIFCYIFSAHPTLGQIDAIEDHISKLYQPPVVRCL

KEILQ TNECSTRCSFYARVIYQKPQ LKNLLAQKEIWLLVTDITLQTQDERDHSLPKTLPVYIAPSCVLGPEVVEELALLVSYNLLFRDAFKDNG GQI

VCIERTVILPQKPLLCVPSASCDLPSPVTLDELSALTPVNSICSVQG GTVVDVDESTAFSWPVCDRCGNGRLEQKPEDG GGTFSCGDCSQLVLSPLQE

RHLHVFLDCPTRPESTVKVK - UNI17647 - LLESSISLLLMSAASEDG - UNI29305 - SYEVESVLGKEMGPLLCFVQSITTQQSSCVVTLE

EIELLSTEGATAAQPPP

For any suggestions or comments, please send an email to unitrap@crg.es