Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041975 (Mettl8)
Chromosomal location
Chr 2: 70802618 - 70893640 (-)
methyltransferase like 8 Gene [Source:MGI (curated);Acc:Mettl8-002]
Mm.444964 Mm.282641 
B0R0U0 B0R0U1 Q8C994 Q8CA70 
Human Ortholog
ENSG00000123600 (METTL8)
Omim not available
UniTrap UNI9917
Vector Insertion
Chr 2: 70893427 - 70893585
Public Clones NPX499 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35094
Vector Insertion
Chr 2: 70889728 - 70893585
Public Clones IST14557C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14175
Vector Insertion
Chr 2: 70856276 - 70856432
Public Clones CMHD-GT_465H12-3 (cmhd) CMHD-GT_47H1-3 (cmhd)
Private Clones OST459770 (lexicon) OST453935 (lexicon) OST430369 (lexicon) OST421265 (lexicon)
OST415161 (lexicon) OST404086 (lexicon) OST391168 (lexicon) OST383403 (lexicon)
OST322983 (lexicon) OST322686 (lexicon) OST314802 (lexicon) OST303516 (lexicon)
OST303248 (lexicon) OST284847 (lexicon) OST269290 (lexicon) OST262077 (lexicon)
OST260930 (lexicon) OST235354 (lexicon) OST196862 (lexicon) OST170062 (lexicon)
OST115989 (lexicon) OST78153 (lexicon) OST77112 (lexicon) OST54914 (lexicon)
OST41437 (lexicon) OST33919 (lexicon) OST33896 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37691
Vector Insertion
Chr 2: 70856276 - 70889791
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16221
Vector Insertion
Chr 2: 70831540 - 70831633
Public Clones not available
Private Clones OST464967 (lexicon) OST316374 (lexicon) OST312793 (lexicon) OST261859 (lexicon)
OST251442 (lexicon) OST185170 (lexicon) OST138581 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100037























 - UNI9917 - - UNI35094 - M - UNI14175 - - UNI16221 - - UNI35094 - MDHMQWSKEEEDAARKKVEENSATRVAPEEQV 




Transcript ENSMUST00000112186




























Transcript ENSMUST00000064905




























Transcript ENSMUST00000121586














Transcript ENSMUST00000038328






















 - UNI9917 - - UNI14175 - - UNI35094 -  - UNI14175 - - UNI16221 - MQWSKEEEDAARKKVEENSATRVAPEEQV - UN



Transcript ENSMUST00000112179

























Transcript ENSMUST00000090849










For any suggestions or comments, please send an email to