Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000041975 (Mettl8)
Chromosomal location
Chr 2: 70802618 - 70893640 (-)
Description
methyltransferase like 8 Gene [Source:MGI (curated);Acc:Mettl8-002]
RefSeq_peptide
NP_663499.2 
UniGene
Mm.444964 Mm.282641 
MGI
MGI:2385142 
Uniprot/SWISSPROT
A2AUU0 
Uniprot/SPTREMBL
B0R0U0 B0R0U1 Q8C994 Q8CA70 
Human Ortholog
ENSG00000123600 (METTL8)
Omim not available
UniTrap UNI9917
Vector Insertion
Chr 2: 70893427 - 70893585
Public Clones NPX499 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35094
Vector Insertion
Chr 2: 70889728 - 70893585
Public Clones IST14557C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14175
Vector Insertion
Chr 2: 70856276 - 70856432
Public Clones CMHD-GT_47H1-3 (cmhd) CMHD-GT_465H12-3 (cmhd)
Private Clones OST459770 (lexicon) OST453935 (lexicon) OST430369 (lexicon) OST421265 (lexicon)
OST415161 (lexicon) OST404086 (lexicon) OST391168 (lexicon) OST383403 (lexicon)
OST322983 (lexicon) OST322686 (lexicon) OST314802 (lexicon) OST303516 (lexicon)
OST303248 (lexicon) OST284847 (lexicon) OST269290 (lexicon) OST262077 (lexicon)
OST260930 (lexicon) OST235354 (lexicon) OST196862 (lexicon) OST170062 (lexicon)
OST115989 (lexicon) OST78153 (lexicon) OST77112 (lexicon) OST54914 (lexicon)
OST41437 (lexicon) OST33919 (lexicon) OST33896 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37691
Vector Insertion
Chr 2: 70856276 - 70889791
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16221
Vector Insertion
Chr 2: 70831540 - 70831633
Public Clones not available
Private Clones OST464967 (lexicon) OST316374 (lexicon) OST312793 (lexicon) OST261859 (lexicon)
OST251442 (lexicon) OST185170 (lexicon) OST138581 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000100037
Sequence
GTGGGTCGGGTAGCCTTCCGGGCTGCACGCGGTAAACCTGGATAGCTTTGGTGGGTGCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAG

GAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCCTGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTG

GGACCCTCCAAAG - UNI9917 - - UNI35094 - AATCATAACGGTTTTAAATATGGAAAACATCTTTGTATTTTCCTGCCATCAAGCCTCAGCA

T - UNI14175 - - UNI16221 - - UNI35094 - GGATCACATGCAGTGGTCTAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAA

ACTCAGCCACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAAGTGACGCTAACAAATACTGGGATATATTTTACCAGACCCAT

AAGAATAAGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCCTGTTAATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCT

GGGATCAAGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAGAGTTTTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGC

TCCTGACCCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTGGTAGCAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGG

TGCTGGAAATAGCGTGTTTCCAATCCTGAACACCTTGCA GAACATTCCAGGATCCTTTCTCTACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGT

AAAG TCCCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTGTGACGACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGA

TGTCGTTCTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GATGCAAGCTGTTGCCCACCGACTGTCCAGGTTGCTGAAGCCCGGAGGAATGCT

ATTGTTTCGGGATCATGGAAGATACGATAATGCTCAGCTTCGTTTTAAGAAAG GGCGTTGTTTATCTGAAAATTTTTATGTCCGAGGAGATGGTACCAG

AGCTTATTTCTTTACAAAAG GGGAAATCCGCCGTATGTTCTGCGAGGCTGGATTACACGAAAAGCAAAATCTGGTTGATCATCGCTTGCAAGTGAACAG

GAAAAAGCAAGTGCAGATGCACCGAGTGTGGATTCAAGGAAAATTCCAGAAACCATCGCCCTGGACTCCACAGAGTGGAAATTAGCATTCACTGCATTCT

CAGGACCGAACTATGTGTCATGTTAAAGTATGAACCCAGGGCCTGATACTGTTCAAAGACTTCTCTTCCAGAGATGAGCAGAAGAGCATCCGCAGCTCTG

CTGGTCTGCTGTCAGTGCTCTCAGGACATTTTAAGAACAAGGATGTGACTTGAAAGAGTCTCCCACCCTCTGGGTTTCCAGAACTTGAAATGTATGTTTG

GTTTTGTTTCATCTAACCATGTTCCCTTGAATTGTATGACTTTGAATTAAGAAGCGTATAGTTTTGAGAAATGTAACCCGTCCATGTTTTAGAAGTGGAA

AAATGATCTACTTTATTGTTGAGTATGGTAAAGCAGTCAAACTGCCCTCTGCTGTCAGCCAGTAGCAGCGGCATAGTGTGCCTTGTTCTTGGGGGAACTC

AGGATGAAGGGTTACTGTGTTTTGTTCTGTTCTTATCTATTTTCTCTCAAAACTCACCAACCACCACCACCACCACCACCACACACAAGTGTCTGAAATA

CAACCTTAGTTTCTCTTTCCAAAAAATGGGGAAGTGTGACCCTTGTTAACATCACTTCCGGGCTATTCTTAGATATGCAGATCATCTTTGAGACACTGTC

TGTGCTGTGGTGGCCAGTTTTAATTGTCAACTTGACACACTCTAGAACCACCCAGGAAGAGTCTCAGATTGTCAGTTGTCTGTGAGATTGTCTTGATTGT

ATTAATTGATGTGGGAAGACTTGTCTACTGTGGGCAGTACCATTCCCTGGAGGTTGGACCCTGAACCAAGTAAGTGTGGGAAAAGGGAGCTGAGCACTGG

CACACCAGTATTCATGCTCGCTCTTCTCCTGACCATGGGTGTAACCAGCTGCTTCAAGCTCCTGCCTCCTTGACTTCCTGCTGTAACTGGGTGGACTGTA

GCTTGGAGTTGTGAGCTAAAATAAACCTTTTCTTCCAAAA
Translation
 - UNI9917 - - UNI35094 - M - UNI14175 - - UNI16221 - - UNI35094 - MDHMQWSKEEEDAARKKVEENSATRVAPEEQV 

- UNI16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVNQNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPD

PDLEEYSKGPGKTEPFPGSNATFRILE VGCGAGNSVFPILNTLQ QNIPGSFLYCCDFASEAVELVK SHESYSEAQCSAFIHDVCDDGLAYPFPDGIL

DVVLLVFVLSSIHPDR RMQAVAHRLSRLLKPGGMLLFRDHGRYDNAQLRFKKG GRCLSENFYVRGDGTRAYFFTKG GEIRRMFCEAGLHEKQNLVDH

RLQVNRKKQVQMHRVWIQGKFQKPSPWTPQSGN
Transcript ENSMUST00000112186
Sequence
GTGGGTCGGGTAGCCTTCCGGGCTGCACGCGGTAAACCTGGATAGCTTTGGTGGGTGCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAG

GAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCCTGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTG

GGACCCTCCAAAG - UNI9917 - - UNI14175 - - UNI35094 - GTCCTGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTG

AGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCCCTCTGGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACA

ACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTCTAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGC

CACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAAGTGACGCTAACAAATACTGGGATATATTTTACCAGACCCATAAGAATA

AGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCCTGTTAATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCTGGGATCA

AGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAGAGTTTTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGCTCCTGAC

CCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTGGTAGCAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGGTGCTGGA

AATAGCGTGTTTCCAATCCTGAACACCTTGCA GAACATTCCAGGATCCTTTCTCTACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGTAAAG TC

CCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTGTGACGACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGATGTCGTT

CTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GATGCAAGCTGTTGCCCACCGACTGTCCAGGTTGCTGAAGCCCGGAGGAATGCTATTGTTT

CGGGATCATGGAAGATACGATAATGCTCAGCTTCGTTTTAAGAAAG GGCGTTGTTTATCTGAAAATTTTTATGTCCGAGGAGATGGTACCAGAGCTTAT

TTCTTTACAAAAG GGGAAATCCGCCGTATGTTCTGCGAGGCTGGATTACACGAAAAGCAAAATCTGGTTGATCATCGCTTGCAAGTGAACAGGAAAAAG

CAAGTGCAGATGCACCGAGTGTGGATTCAAGGAAAATTCCAGAAACCATCGCCCTGGACTCCACAGAGTGGAAATTAGCATTCACTGCATTCTCAGGACC

GAACTATGTGTCATGTTAAAGTATGAACCCAGGGCCTGATACTGTTCAAAGACTTCTCTTCCAGAGATGAGCAGAAGAGCATCCGCAGCTCTGCTGGTCT

GCTGTCAGTGCTCTCAGGACATTTTAAGAACAAGGATGTGACTTGAAAGAGTCTCCCACCCTCTGGGTTTCCAGAACTTGAAATGTATGTTTGGTTTTGT

TTCATCTAACCATGTTCCCTTGAATTGTATGACTTTGAATTAAGAAGCGTATAGTTTTGAGAAATGTAACCCGTCCATGTTTTAGAAGTGGAAAAATGAT

CTACTTTATTGTTGAGTATGGTAAAGCAGTCAAACTGCCCTCTGCTGTCAGCCAGTAGCAGCGGCATAGTGTGCCTTGTTCTTGGGGGAACTCAGGATGA

AGGGTTACTGTGTTTTGTTCTGTTCTTATCTATTTTCTCTCAAAACTCACCAACCACCACCACCACCACCACCACACACAAGTGTCTGAAATACAACCTT

AGTTTCTCTTTCCAAAAAATGGGGAAGTGTGACCCTTGTTAACATCACTTCCGGGCTATTCTTAGATATGCAGATCATCTTTGAGACACTGTCTGTGCTG

TGGTGGCCAGTTTTAATTGTCAACTTGACACACTCTAGAACCACCCAGGAAGAGTCTCAGATTGTCAGTTGTCTGTGAGATTGTCTTGATTGTATTAATT

GATGTGGGAAGACTTGTCTACTGTGGGCAGTACCATTCCCTGGAGGTTGGACCCTGAACCAAGTAAGTGTGGGAAAAGGGAGCTGAGCACTGGCACACCA

GTATTCATGCTCGCTCTTCTCCTGACCATGGGTGTAACCAGCTGCTTCAAGCTCCTGCCTCCTTGACTTCCTGCTGTAACTGGGTGGACTGTAGCTTGGA

GTTGTGAGCTAAAATAAACCTTTTCTTCC
Translation
 - UNI9917 - - UNI14175 - - UNI35094 - MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMW - UNI14175 -

 - UNI16221 - WDHMQWSKEEEDAARKKVEENSATRVAPEEQV - UNI16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVN

QNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILE VGCGAGNSVFPILNTLQ QNIPGSF

LYCCDFASEAVELVK SHESYSEAQCSAFIHDVCDDGLAYPFPDGILDVVLLVFVLSSIHPDR RMQAVAHRLSRLLKPGGMLLFRDHGRYDNAQLRFKK

G GRCLSENFYVRGDGTRAYFFTKG GEIRRMFCEAGLHEKQNLVDHRLQVNRKKQVQMHRVWIQGKFQKPSPWTPQSGN
Transcript ENSMUST00000064905
Sequence
GTGGGTCGGGTAGCCTTCCGGGCTGCACGCGGTAAACCTGGATAGCTTTGGTGGGTGCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAG

GAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCCTGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTG

GGACCCTCCAAAG - UNI9917 - - UNI14175 - - UNI35094 - GTCCTGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTG

AGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCCCTCTGGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACA

ACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTCTAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGC

CACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAAGTGACGCTAACAAATACTGGGATATATTTTACCAGACCCATAAGAATA

AGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCCTGTTAATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCTGGGATCA

AGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAGAGTTTTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGCTCCTGAC

CCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTGGTAGCAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGGTGCTGGA

AATAGCGTGTTTCCAATCCTGAACACCTTGCA GAACATTCCAGGATCCTTTCTCTACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGTAAAG TC

CCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTGTGACGACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGATGTCGTT

CTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GATGCAAGCTGTTGCCCACCGACTGTCCAGGTTGCTGAAGCCCGGAGGAATGCTATTGTTT

CGGGATCATGGAAGATACGATAATGCTCAGCTTCGTTTTAAGAAAG GGCGTTGTTTATCTGAAAATTTTTATGTCCGAGGAGATGGT CCAGAGCTTAT

TTCTTTACAAAAG GGGAAATCCGCCGTATGTTCTGCGAGGCTGGATTACACGAAAAGCAAAATCTGGTTGATCATCGCTTGCAAGTGAACAGGAAAAAG

CAAGTGCAGATGCACCGAGTGTGGATTCAAGGAAAATTCCAGAAACCATCGCCCTGGACTCCACAGAGTGGAAATTAGCATTCACTGCATTCTCAGGACC

GAACTATGTGTCATGTTAAAGTATGAACCCAGGGCCTGATACTGTTCAAAGACTTCTCTTCCAGAGATGAGCAGAAGAGCATCCGCAGCTCTGCTGGTCT

GCTGTCAGTGCTCTCAGGACATTTTAAGAACAAGGATGTGACTTGAAAGAGTCTCCCACCCTCTGGGTTTCCAGAACTTGAAATGTATGTTTGGTTTTGT

TTCATCTAACCATGTTCCCTTGAATTGTATGACTTTGAATTAAGAAGCGTATAGTTTTGAGAAATGTAACCCGTCCATGTTTTAGAAGTGGAAAAATGAT

CTACTTTATTGTTGAGTATGGTAAAGCAGTCAAACTGCCCTCTGCTGTCAGCCAGTAGCAGCGGCATAGTGTGCCTTGTTCTTGGGGGAACTCAGGATGA

AGGGTTACTGTGTTTTGTTCTGTTCTTATCTATTTTCTCTCAAAACTCACCAACCACCACCACCACCACCACCACACACAAGTGTCTGAAATACAACCTT

AGTTTCTCTTTCCAAAAAATGGGGAAGTGTGACCCTTGTTAACATCACTTCCGGGCTATTCTTAGATATGCAGATCATCTTTGAGACACTGTCTGTGCTG

TGGTGGCCAGTTTTAATTGTCAACTTGACACACTCTAGAACCACCCAGGAAGAGTCTCAGATTGTCAGTTGTCTGTGAGATTGTCTTGATTGTATTAATT

GATGTGGGAAGACTTGTCTACTGTGGGCAGTACCATTCCCTGGAGGTTGGACCCTGAACCAAGTAAGTGTGGGAAAAGGGAGCTGAGCACTGGCACACCA

GTATTCATGCTCGCTCTTCTCCTGACCATGGGTGTAACCAGCTGCTTCAAGCTCCTGCCTCCTTGACTTCCTGCTGTAACTGGGTGGACTGTAGCTTGGA

GTTGTGAGCTAAAATAAACCTTTTCTTCC
Translation
 - UNI9917 - - UNI14175 - - UNI35094 - MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMW - UNI14175 -

 - UNI16221 - WDHMQWSKEEEDAARKKVEENSATRVAPEEQV - UNI16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVN

QNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILE VGCGAGNSVFPILNTLQ QNIPGSF

LYCCDFASEAVELVK SHESYSEAQCSAFIHDVCDDGLAYPFPDGILDVVLLVFVLSSIHPDR RMQAVAHRLSRLLKPGGMLLFRDHGRYDNAQLRFKK

G GRCLSENFYVRGDG PELISLQK GKSAVCSARLDYTKSKIWLIIACK
Transcript ENSMUST00000121586
Sequence
GTCCTGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTGAGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCC

CTCTGGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACAACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTC

TAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGCCACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAA

GTGACGCTAACAAATACTGGGATATATTTTACCAGACCCATAAGAATAAGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCC

TGTTAATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCTGGGATCAAGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAG

AGTTTTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGCTCCTGACCCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTG

GTAGCAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGGTGCTGGAAATAGCGTGTTTCCAATCCTGAACACCTTGCA GAACATTCCAGGATCCTTT

CTCTACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGTAAAG TCCCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTGT

GACGACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGATGTCGTTCTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GGCGTTGTTTATC

TGAAAATTTTTATGTCCGAGGAGATGGTACCAGAGCTTATTTCTTTACAAAAG GGGAAATCCGCCGTATGTTCTGCGAGGCTGGATTACACGAAAAGCA

AAATCTGGTTGATCATCGCTTGCAAGTGAACAGGAAAAAGCAAGTGCAGATGCACCGAGTGTGGATTCAAGGAAAATTCCAGAAACCATCGCCCTGGACT

CCACAGAGTGGAAATTAGCATTCACTGCATTCTCAGGACCGAACTATGTGTCATGTTAAAGTATGAACCCAGGGCCTGATACTGTTCAAAGACTTCT
Translation
MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMW - UNI14175 - - UNI16221 - WDHMQWSKEEEDAARKKVEENSATR

VAPEEQV - UNI16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVNQNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPG

SRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILE VGCGAGNSVFPILNTLQ QNIPGSFLYCCDFASEAVELVK SHESYSEAQCSAFIHDVCDDGLA

YPFPDGILDVVLLVFVLSSIHPDR RALFI 
Transcript ENSMUST00000038328
Sequence
GCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAGGAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCC

TGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTGGGACCCTCCAAAG - UNI9917 - - UNI14175 - - UNI35094 - GTCC

TGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTGAGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCCCTCT

GGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACAACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTCTAAA

GAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGCCACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAAGTGA

CGCTAACAAATACTGGGATATATTTTACCAGACCCATAAGAATAAGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCCTGTT

AATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCTGGGATCAAGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAGAGTT

TTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGCTCCTGACCCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTGGTAG

CAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGGTGCTGGAAATAGCGTGTTTCCAATCCTGAACACCTTGCA GAACATTCCAGGATCCTTTCTCT

ACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGTAAAG TCCCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTGTGACG

ACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGATGTCGTTCTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GCAGGTACCACCATGCC

TACCCAACAGAACTTGTGATTTTTATAAGATGTCACAGCCCCCAGGAAGAGGGTACAGACCTGCATAAGATCCCTGTTGCTTGATAGTGTGATCCCTTCC

CAGAGAAAG GATGCAAGCTGTTGCCCACCGACTGTCCAGGTTGCTGAAGCCCGGAGGAATGCTATTGTTTCGGGATCATGGAAGATACGATAATGCTCA

GCTTCGTTTTAAGAAAG GGCGTTGTTTATCTGAAAATTTTTATGTCCGAGGAGATGGTACCAGAGCTTATTTCTTTACAAAAG GGGAAATCCGCCGTA

TGTTCTGCGAGGCTGGATTACACGAAAAGCAAAATCTGGTTGATCATCGCTTGCAAGTGAACAGGAAAAAGCAAGTGCAGATGCACCGAGTGTGGATTCA

AGGAAAATTCCAGAAACCATCGCCCTGGACTCCACAGAGTGGAAATTAGCATTCACTGCATTCTCAGGACCGAACTATGTGTCATGTTAAAGTATGAACC

CAGGGCCTGATACTGTTCAAAGACTTCTCTTCCAGAGATGAGCAGAAGAGCATCCGCAGCTCTGCTGGTCTGCTGTCAGTGCTCTCAGGACATTTTAAGA

ACAAGGATGTGACTTGAAAGAGTCTCCCACCCTCTGGGTTTCCAGAACTTGAAATGTATGTTTGGTTTTGTTTCATCTAACCATGTTCCCTTGAATTGTA

TGACTTTGAATTAAGAAGCGTATAGTTTTGAGAAATGTAACCCGTCCATGTTTTAGAAGTGGAAAAATGATCTACTTTATTGTTGAGTATGGTAAAGCAG

TCAAACTGCCCTCTGCTGTCAGCCAGTAGCAGCGGCATAGTGTGCCTTGTTCTTGGGGGAACTCAGGATGAAGGGTTACTGTGTTTTGTTCTGTTCTTAT

CTATTTTCTCTCAAAACTCACCAACCACCACCACCACCACCACCACACACAAGTGTCTGAAATACAACCTTAGTTTCTCTTTCCAAAAAATGGGGAAGTG

TGACCCTTGTTAACATCACTTCCGGGCTATTCTTAGATATGCAGATCATCTTTGAGACACTGTCTGTGCTGTGGTGGCCAGTTTTAATTGTCAACTTGAC

ACACTCTAGAACCACCCAGGAAGAGTCTCAGATTGTCAGTTGTCTGTGAGATTGTCTTGATTGTATT
Translation
 - UNI9917 - - UNI14175 - - UNI35094 -  - UNI14175 - - UNI16221 - MQWSKEEEDAARKKVEENSATRVAPEEQV - UN

I16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVNQNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPDPDLE

EYSKGPGKTEPFPGSNATFRILE VGCGAGNSVFPILNTLQ QNIPGSFLYCCDFASEAVELVK SHESYSEAQCSAFIHDVCDDGLAYPFPDGILDVVL

LVFVLSSIHPDR RQVPPCLPNRTCDFYKMSQPPGRGYRPA   
Transcript ENSMUST00000112179
Sequence
GTGGGTCGGGTAGCCTTCCGGGCTGCACGCGGTAAACCTGGATAGCTTTGGTGGGTGCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAG

GAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCCTGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTG

GGACCCTCCAAAG - UNI9917 - - UNI14175 - - UNI35094 - GTCCTGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTG

AGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCCCTCTGGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACA

ACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTCTAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGC

CACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - TTAAGTTTGAAAGTGACGCTAACAAATACTGGGATATATTTTACCAGACCCATAAGAATA

AGTTTTTCAAGAATCGTAATTGGCTGTTGAGGGAATTTCCTGAAATCCTTCCTGTTAATCAAAACACTAAAGAGAAAGTGGGAGAATCATCCTGGGATCA

AGTCGGAAGCAGCATCTCTAGGACACAAGGAACAGAAACCCATTGTCAAGAGAGTTTTGTCTCGCCAGAACCTGGGAGCAGAGGACGGTCTGCTCCTGAC

CCCGACTTGGAAGAATACAGCAAAGGACCTGGGAAGACAGAGCCGTTTCCTGGTAGCAATGCCACTTTTCGAATACTAGAG GAACATTCCAGGATCCTT

TCTCTACTGCTGCGACTTTGCCTCTGAAGCTGTGGAACTTGTAAAG TCCCACGAGTCCTACAGCGAGGCCCAGTGTTCTGCCTTTATTCATGACGTGTG

TGACGACGGCTTAGCCTACCCTTTCCCAGATGGGATCCTGGATGTCGTTCTCCTTGTCTTTGTGCTCTCATCTATCCACCCTGACAG GATGCAAGCTGT

TGCCCACCGACTGTCCAGGTTGCTGAAGCCCGGAGGAATGCTATTGTTTCGGGATCATGGAAGATACGATAATGCTCAGCTTCGTTTTAAGAAAG GGCG

TTGTTTATCTGAAAATTTTTATGTCCGAGGAGATGGTACCAGAGCTTATTTCTTTACAAAAG GGGAAATCCGCCGTATGTTCTGCGAGGCTGGATTACA

CGAAAAGCAAAATCTGGTTGATCATCGCTTGCAAGTGAACAGGAAAAAGCAAGTGCAGATGCACCGAGTGTGGATTCAAGGAAAATTCCAGAAACCATCG

CCCTGGACTCCACAGAGTGGAAATTAGCATTCACTGCATTCTCAGGACCGAACTATGTGTCATGTTAAAGTATGAACCCAGGGCCTGATACTGTTCAAAG

ACTTCTCTTCCAGAGATGAGCAGAAGAGCATCCGCAGCTCTGCTGGTCTGCTGTCAGTGCTCTCAGGACATTTTAAGAACAAGGATGTGACTTGAAAGAG

TCTCCCACCCTCTGGGTTTCCAGAACTTGAAATGTATGTTTGGTTTTGTTTCATCTAACCATGTTCCCTTGAATTGTATGACTTTGAATTAAGAAGCGTA

TAGTTTTGAGAAATGTAACCCGTCCATGTTTTAGAAGTGGAAAAATGATCTACTTTATTGTTGAGTATGGTAAAGCAGTCAAACTGCCCTCTGCTGTCAG

CCAGTAGCAGCGGCATAGTGTGCCTTGTTCTTGGGGGAACTCAGGATGAAGGGTTACTGTGTTTTGTTCTGTTCTTATCTATTTTCTCTCAAAACTCACC

AACCACCACCACCACCACCACCACACACAAGTGTCTGAAATACAACCTTAGTTTCTCTTTCCAAAAAATGGGGAAGTGTGACCCTTGTTAACATCACTTC

CGGGCTATTCTTAGATATGCAGATCATCTTTGAGACACTGTCTGTGCTGTGGTGGCCAGTTTTAATTGTCAACTTGACACACTCTAGAACCACCCAGGAA

GAGTCTCAGATTGTCAGTTGTCTGTGAGATTGTCTTGATTGTATTAATTGATGTGGGAAGACTTGTCTACTGTGGGCAGTACCATTCCCTGGAGGTTGGA

CCCTGAACCAAGTAAGTGTGGGAAAAGGGAGCTGAGCACTGGCACACCAGTATTCATGCTCGCTCTTCTCCTGACCATGGGTGTAACCAGCTGCTTCAAG

CTCCTGCCTCCTTGACTTCCTGCTGTAACTGGGTGGACTGTAGCTTGGAGTTGTGAGCTAAAATAAACCTTTTCTTCC
Translation
 - UNI9917 - - UNI14175 - - UNI35094 - MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMW - UNI14175 -

 - UNI16221 - WDHMQWSKEEEDAARKKVEENSATRVAPEEQV - UNI16221 - VKFESDANKYWDIFYQTHKNKFFKNRNWLLREFPEILPVN

QNTKEKVGESSWDQVGSSISRTQGTETHCQESFVSPEPGSRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILE EHSRILSLLLRLCL    
Transcript ENSMUST00000090849
Sequence
GTGGGTCGGGTAGCCTTCCGGGCTGCACGCGGTAAACCTGGATAGCTTTGGTGGGTGCTGTGCAGCCACCTGGTGGTGTCGCTTCACCTGTGTGTCCCAG

GAAGCAGTCCCTTTCTGCCCTGGTCGTGGGACGACTGCCAACCCCTCCTTTGGCCCTGCAAGGCTCTGGCCACGCGTCCAGAGGGGCGTTGTGGCCAGTG

GGACCCTCCAAAG - UNI9917 - - UNI14175 - - UNI35094 - GTCCTGCTTAGGATGAATGTGATTTGGAGAAGTTGCATTTGCCGACTG

AGGCAGGGGAAGGTACCACACCGATGCCAGAGTGGCGTCCACCCGGTAGCCCCTCTGGGGTCGAGGATTTTAACTGACCCCGCCAAAGTTTTTGAACACA

ACATGTG - UNI14175 - - UNI16221 - GGATCACATGCAGTGGTCTAAAGAAGAAGAAGACGCAGCTAGAAAAAAGGTAGAGGAAAACTCAGC

CACACGAGTCGCTCCAGAAGAGCAAG - UNI16221 - AACCTGGGAGCAGAGGACGGTCTGCTCCTGACCCCGACTTGGAAGAATACAGCAAAGGAC

CTGGGAAGACAGAGCCGTTTCCTGGTAGCAATGCCACTTTTCGAATACTAGAG GTTGGCTGTGGTGCTGGAAATAGCGTGTTTCCAATCCTGAACACCT

TGCA AAGGCAGAAGGGGAAAGAGCGAGAGATTGCCACCCCCCACCACCACCACCAAGCAGTGCCTTGCTTAGCGTCAGACATGGCGTGCTCCTCCTGA
Translation
 - UNI9917 - - UNI14175 - - UNI35094 - MNVIWRSCICRLRQGKVPHRCQSGVHPVAPLGSRILTDPAKVFEHNMW - UNI14175 -

 - UNI16221 - WDHMQWSKEEEDAARKKVEENSATRVAPEEQE - UNI16221 - EPGSRGRSAPDPDLEEYSKGPGKTEPFPGSNATFRILE V

GCGAGNSVFPILNTLQ QRQKGKEREIATPHHHHQAVPCLASDMACSS

For any suggestions or comments, please send an email to unitrap@crg.es