Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042015 (Wdr41)
Chromosomal location
Chr 13: 95746303 - 95793269 (+)
Description
WD repeat domain 41 Gene [Source:MGI Symbol;Acc:MGI:2445123]
RefSeq_peptide
NP_766178.2 
UniGene
Mm.33856 
MGI
MGI:2445123 
Uniprot/SWISSPROT
Q3UDP0 
Uniprot/SPTREMBL
B2RQV3 
Human Ortholog
ENSG00000164253 (WDR41)
Omim not available
UniTrap UNI21777
Vector Insertion
Chr 13: 95746545 - 95748424
Public Clones not available
Private Clones OST318205 (lexicon) OST66641 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046437
Sequence
CAACCGCGCGGCGCCCACGCGCGTGCTCACTGGGGACGCGGAACCTCCGCCTCCGCCGTCGCGGCCTTCAGTGCGGGCGCCCCAACGAGACTTCTGTTTT

CCCGCTGCCTCGCCCCAGGCTCACTCGGCCGCAGCCCCAGCACCTGCGCCGCGGCGGCCCTCGCTCCGTGGGCCGCGGACGCCCCGGCCCGATGCTGCGC

TGGCTGATCGGAGGAGGCCGCGAGCCGCAGGGCCTAGCCGAG - UNI21777 - AAAGCTGCTTTGCAGACAATAGGAGAGGACCAAGGTCAGAACCC

CTATACTGAACTGCTGGTACTGGAGGCTCATCGCGACATTGTCCGCTTCCTGGTGAGGCTCGATGACTTCAG GTTTGCATCTGCTGGCGATGATGGAAT

TATAGTTGTGTGGAATGCCCAG ACAGGAGAAAAACTTCTGGAACTCAGAGGACACACTCAGAAGATAACGGCTGTCATTGCGTTTCCTCCCCTAGACTC

GTGTGAGGCCAGCAGTCAGCTTCTCTTGACAGCCTCGGCTGACCGGACTGTCGGTA TTTGGGATTGCGACACCGGCCGGCAAATCCAGAGAGTCACGTG

CTTCCAGTCTACGGTAAAG TGCTTGACCGTTCTTCAGAGACTGGACATTTGGCTGTCAGGCGGTAGTGACCTAGGCGTGTGGAACCGAAAGTTAGATCT

GCTGTGTAAAACCAGCCACCTATCCGACACAG GGATCAGTGCTTTGGTTGAAATCCCTGGGAACTGTGTCGCCGCAGCAGTGGGCAGAGAATTGA TAA

TTTTTAGGCTTGTGACACCCACAGAAGAATTGCCGGAATGGGATATTATTGAAGTTAAACGCCTTCTTGATCACCAGGACAATATTCTGTCATTGGCTAA

CATCAATG GCTCTGTGCTGACCATGGGCTCTGTGCTGACCACGGGCTCTGTGCTGACCATAGGCTCTGTGCTGACCACAGGCTCTGTGCTGACCATGGG

CTCTGTGCTGACCACAGGCTCTGTGCTGACCGCAGGCTCTGTGCTGACCATGGGCTCTGTGCTGACCGCAGGCTCTGTGCTGACCATGGGCTCTGTGCTG

ACTGCAGGCGCTGTGCTGCCCGCAGGCTCTGTGCTGA
Translation
MLRWLIGGGREPQGLAE - UNI21777 - KAALQTIGEDQGQNPYTELLVLEAHRDIVRFLVRLDDFR RFASAGDDGIIVVWNAQ TGEKLLELRGH

TQKITAVIAFPPLDSCEASSQLLLTASADRTVGI IWDCDTGRQIQRVTCFQSTVK CLTVLQRLDIWLSGGSDLGVWNRKLDLLCKTSHLSDTG GISA

LVEIPGNCVAAAVGRELI IIFRLVTPTEELPEWDIIEVKRLLDHQDNILSLANING GSVLTMGSVL
Transcript ENSMUST00000056512
Sequence
CAACCGCGCGGCGCCCACGCGCGTGCTCACTGGGGACGCGGAACCTCCGCCTCCGCCGTCGCGGCCTTCAGTGCGGGCGCCCCAACGAGACTTCTGTTTT

CCCGCTGCCTCGCCCCAGGCTCACTCGGCCGCAGCCCCAGCACCTGCGCCGCGGCGGCCCTCGCTCCGTGGGCCGCGGACGCCCCGGCCCGATGCTGCGC

TGGCTGATCGGAGGAGGCCGCGAGCCGCAGGGCCTAGCCGAG - UNI21777 - AAAGCTGCTTTGCAGACAATAGGAGAGGACCAAGGTCAGAACCC

CTATACTGAACTGCTGGTACTGGAGGCTCATCGCGACATTGTCCGCTTCCTGGTGAGGCTCGATGACTTCAG GTTTGCATCTGCTGGCGATGATGGAAT

TATAGTTGTGTGGAATGCCCAG ACAGGAGAAAAACTTCTGGAACTCAGAGGACACACTCAGAAGATAACGGCTGTCATTGCGTTTCCTCCCCTAGACTC

GTGTGAGGCCAGCAGTCAGCTTCTCTTGACAGCCTCGGCTGACCGGACTGTCGGT GTTTGGGATTGCGACACCGGCCGGCAAATCCAGAGAGTCACGTG

CTTCCAGTCTACGGTAAAG TGCTTGACCGTTCTTCAGAGACTGGACATTTGGCTGTCAGGCGGTAGTGACCTAGGCGTGTGGAACCGAAAGTTAGATCT

GCTGTGTAAAACCAGCCACCTATCCGACACAG GGATCAGTGCTTTGGTTGAAATCCCTGGGAACTGTGTCGCCGCAGCAGTGGGCAGAGAATTGA TAA

TTTTTAGGCTTGTGACACCCACAGAAGAATTGCCGGAATGGGATATTATTGAAGTTAAACGCCTTCTTGATCACCAGGACAATATTCTGTCATTGGCTAA

CATCAATG ATACAGGTTTCGTCACTGGCTCCCACGTTGGCGAGCTGCTCATCTGGGATGCCCTGGACTGGACTGTGCAGGCCTGTGAGCGCACCTTCTG

GAGCCCGACCGCACAGCTGGATGCCCAGCAGGAAATAAAGCTCTTCCAAAAACAAAATGATATTTCTATTAATCATTTCACATGCGATGAAGAG AATAT

ATTTGCTGCAGTTGGAAGGGGGTTATATGTGTATAACCTACAGTTGAAGCGTGTGATTGCCTGCCAGAAAACTGCACATGATTCCAACATCCTACACATC

GATAAACTTCCAAACAG GCAGTTAATCTCATGCTCGGAAGATGGCGCTGTGCGCATGTGGGAGGTCCGAGAAAAACAGCAGCTGGCAGCTGAGCCAGTC

CCAACAG GATTTTTTAATATGTGGGGATTTGGAAGAGTAAACAAACAGGCCAGCCAGCCTGTTAAAAAGCAGGAAGAAAACGTTACCACGTGTTCCCTG

GAGCTCATCGGAGATCTCATTGGACATTCATCGTCTGTCGAG ATGTTTCTATACTTTGAGGATCATGGACTAGTGACATGCTCTGCAGATCATCTCATT

ATTTTGTGGAAAAATGGAGAGCGAGAATCTGGAGTACGCAGCTTAAAGTTATTTCAGAAGTTAGAAGAGAACGGTGACTTATACCCAGAGTCCCCTTGAA

GGAGCCAGACAGGCGTGCAGACCCGAACCCCGCACAGCCAACACAGCGCGCCCGGTACCCTGAAAACCATCAGCACACTGACCCCTTACTGTACTCTTTT

CTTGCCTGTGAAGGTCTGTCTGTCTGTCTGTCTGTCTGTCTGTAACACCTGTCCACTCAAGAACATAGCACAACATGGCCTTGTTGCTGTGCAAGTGGTG

GGTGCTGTGTTCTGTCCCTTAAAACGGTAGAAAAAATGATAACTGTAAGGTTGCCACACACTATTTACAAGTGTTCTTTTGGGTTCCCTTAGAGACTGTC

TGAGACTTGTCATGGGAGATGTATCCTCTCTGCTGCTCCTCAGAAGCCATCTGTGTCCAACAGAACCAGACTTGAATATTAGCCCCCCAAAAGGAATTCT

ACTCTTTAAGTACAATGATTTTGTTTGGTACCAACTAATTTAAGTCATTGAAAAAATAATATTTACTCTTGCCCACTAAAATCCCTGTGTCCTCCGGTCC

CCAGGCGTCATCTGAGCATTTCTTTCTCAGTGTGAACTGGCCTGACCCCTCACTGACAGAATAGTCTTCAGGTGTTTCTGGGATGCGTCCTGGGTTAGGA

AGGAGGCACAGCTTTTTCTCAGGTCAGGAACTGTAGCTGAGTTGTCCTGTTTGCCTTAAATGGTTGAGAGCAGCTTCACTGTTCAGCTCTCTGAACATCC

ACTAAGACTGGACCATGTTCCTCGCCCTACCAGCCTGATGACAGTACTCACTTTGGGCACTAAAATGTAAAATATACTCCACACAGTAAGAATGGGGGAG

GGGAGGGTTGATTAAGAAATCTTATTAAAGACAGGCAAGATGAATGTACGTCTACAGATGTGTGTGTGTACACACGTACTCTGCTCCCTAGATGGACACG

CGAAATTCTTGCTTCCGCTAGTTCTAACATTCACAGCTGTCTACAGCCAAAGCTTGGTAGCATTAAAATCATAGGGCGATGAGTGGCAAAATGTTAGACG

TGAGGAAGCCAAGACCGGGGTAGGAAAGCCCTCTCTCCAGTGCCCATCACCATCACTGAACAGCCTTAAAAGCAGAGGCCAGAGGAGGAGAGTGAGGAGG

GCTGAGCGGGTGACCTGGTGACCAAGTTAGGAAAACCAGAGTGTTCCCAGTCCTTGCTGCTGGCACAGTTCACAATGAAAATAGCTTTATATAAAAAGAT

AGCATTACAGCATGAGCTGCCTTAGTTAGGACGTAGCAGGATGCAAATGGGAAAATCTAGTGTCTTTTAGCCAGAAAACCATTGTTCTTTGAGGAGTCAG

CACAGGAGGCAGGTTTGTCATCACCCACCCTGCAGATGTCATGGGGGAAGCACCCACCAGCCAGGCAGACGCGCCGTCCGCTCAAAGTGACAGGAGTGCA

TCCCCTTGCCGTTTACTTTGGCTAAATTGTTTTAGGCTATTGGTTTGTAAAGATGTTTTCTTAAATAATATAAGACAAAGAACTCATA
Translation
MLRWLIGGGREPQGLAE - UNI21777 - KAALQTIGEDQGQNPYTELLVLEAHRDIVRFLVRLDDFR RFASAGDDGIIVVWNAQ TGEKLLELRGH

TQKITAVIAFPPLDSCEASSQLLLTASADRTVG VWDCDTGRQIQRVTCFQSTVK CLTVLQRLDIWLSGGSDLGVWNRKLDLLCKTSHLSDTG GISAL

VEIPGNCVAAAVGRELI IIFRLVTPTEELPEWDIIEVKRLLDHQDNILSLANIND DTGFVTGSHVGELLIWDALDWTVQACERTFWSPTAQLDAQQEI

KLFQKQNDISINHFTCDEE NIFAAVGRGLYVYNLQLKRVIACQKTAHDSNILHIDKLPNR RQLISCSEDGAVRMWEVREKQQLAAEPVPTG GFFNMW

GFGRVNKQASQPVKKQEENVTTCSLELIGDLIGHSSSVE MFLYFEDHGLVTCSADHLIILWKNGERESGVRSLKLFQKLEENGDLYPESP

For any suggestions or comments, please send an email to unitrap@crg.es