Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042032 (Mat2b)
Chromosomal location
Chr 11: 40492818 - 40508325 (-)
Description
methionine adenosyltransferase II, beta Gene [Source:MGI (curated);Acc:Mat2b-001]
RefSeq_dna
NM_134017 
RefSeq_peptide
NP_598778.1 
UniGene
Mm.293771 Mm.402011 Mm.475413 
MGI
MGI:1913667 
Uniprot/SWISSPROT
Q99LB6 
Human Ortholog
ENSG00000038274 (MAT2B)
Omim not available
UniTrap UNI4851
Vector Insertion
Chr 11: 40506148 - 40508304
Public Clones XT0009 (sanger) AH0143 (sanger) (sanger) RRS685 (baygenomics) E051A12 (ggtc)
PST26097-NR (escells) IST15004C6 (tigm) IST14580H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23269
Vector Insertion
Chr 11: 40498987 - 40501298
Public Clones not available
Private Clones OST267933 (lexicon) OST254739 (lexicon) OST238311 (lexicon) OST149150 (lexicon)
OST145492 (lexicon) OST100565 (lexicon) OST50211 (lexicon) OST45534 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29519
Vector Insertion
Chr 11: 40498987 - 40506131
Public Clones P118D05 (ggtc) IST10493A8 (tigm) IST14505D2 (tigm) IST14505E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25055
Vector Insertion
Chr 11: 40498844 - 40501102
Public Clones not available
Private Clones OST197065 (lexicon) OST112420 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6515
Vector Insertion
Chr 11: 40498337 - 40498728
Public Clones CSC104 (baygenomics)
Private Clones OST303797 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109307
Sequence
GGGCCAAGGGCGCGGGCGCTGCGGCCCCTGGCAGTGCTGCGCTAGTGGAGCTTGCGGTCGCGACTGAAGCGGCGCAAAGACTGCGGGCATGGTGGGCCGG

GAGAAGGAGCTCTCCATCCACTTCGTCCCCGGCTGCTGCCAGCTGGTGGAG - UNI23269 - - UNI29519 - GAGGAAGTGAACATCCCTAGCC

GGCGGGTTCTCATTACTGGTGCCACTGGGCTTCTTGGCAGAGCAGTTTACAAAGAGTTTCAGCAGAGCAACTGGCACACCGTTGGCTGTGGCTTTCGAAG

AGCAAGACCAAAATTCGAACAAGTGAACCTGTTGGATTCTGAAGCTGTTCATCACCTCATTCATGATTTCCAGGTATGGGCTTGTATGTCTGCAGTTGTT

ATGTGTTCTCTTAGGACTTGCCTGGCTTATACAGAAAGTGTGTGCTTGGTTTGGTTGCGGGAAGTTGTGCTTGAAAGTTGTGACCCGTTGAGCCACCACA

ATGCAGAGTGTCCTTGTGTGGCATGCTGTGGAGTGGTGCTTGGTGTTGAGGCAAGAGGTTCCCGAGCGTGCTGGCAGGTGTTCTGTCCCAGAGCTGGATC

CTCTTCCCTGTCCTCCACAGCATGTGGGGAGGCATGGCTTGTGTTGATGCAGTACTTTCCTTGTGATGCTTGCCGTGAAGTGTTAGGGTGCTGTCTGGGA

ACGGGGTGGGGGTTGGGGGGGGGTGGAAATATTTCTGCTTTAATGTTAAGAAAGTATGATCAGGGGAACTTCAGTAACCTGTTTGCTGTAACCTGACAAA

AGTTAGAGGAAAATGAAGACTTTGTTCTCCTTGCCATCCGATTTCAGCTTTGGTTCTCTCTAAGTGTGATTCTGGAAGCATGAGTATTAGAAACACACAG

AAGCCTGATTGCAGACTGCATGCCCAGAGTGTGATGTTTTAAGTCTGGGGCGGGCCTAGGATATTGTATTTGAAACATCCCAGATTCCCCACATTCAAGT

TTGAAAACAATTCTTAGCAATCCTTGAGCAATTTTTGAGAAAATGGGTGTGTGGACAGTCTATCTGTCTGTCTCTCGTTTATTTTTATTTGTTTTCTGTG

TACGGGTGTTTTGCCTGCATGTATGTCTATATAACACATACATGTAGTACCTGTGGAAGTCAGAAAAGGGTGCCTGATCTCCTGATCTATTTATTCTTGT

TTTGTATGCATTGGTGTTTGTCTGTGCGTATGTCTCTGTGAGTGTCAGATCCCCTGCAATTCCAGTGAGTTCTGAGCTGCCTTGTGGGTGTTGGGAACTG

AACCTGGATCCTCTGGAAGAGCAGCCTGTGCTTTTAACCACTGAGATCTCTCTCCAGCCTCTGAAACTGGAGCTATAAATGGTTGTTAGCCATGTGCGTT

CCAGCCTCCAGCACACAGACATTGAACACCAATCTTAGTTCTTGCTCTGTTCTTGCATTAAAAAAGCCTTTTCTTTAGAAGATCTGCATCCTTGTTTTGA

TGTGTATCTCTTTCACCCAGATGTGAAGACCTTGTCTGTGGCCTTACTGGTGTGTGGTGGTTAGTTGTCATCTGCAAAGGGAATTTCAATTGGGAAATGC

CTCTAACAGTGTGGTCCGTGGGGGTTTTGTGATTAATATGACTGTGGCTGAGCCTGAGTTGCTTATGAAAATAGGTTGAACATGCTATGGGGAGCAAGCC

TGTGAGCAGAGTTCATCCATTTCCTTGCTACCAGTTACCAGTCCCTTCTTTGACTTTCTTTGGTGATGGACTTTGGGCTGTAAGTGATAAGCCATTTCTT

CCTCAAGTTGCTTTGGATCCACAGTAATAGAAAAATAGCTAAGACATGGGGGCTTACTGCTTTTATAGTCAAGTGGACATGTGATTTCTGTAAATAGCTG

ATTCTTGTTAAATGAGTGGTCAAAAAAGCTTGAATTTATGAATTTAACTCGCAACTGATACTACTTGCCGTTTGTCATGAGTTTGGTAACTGTTAGGGTT

GGGGCATCGCATCTTGGCAGAGCACTTGGCTGTCTGTGGGGCCTGGGGTTTGGTGAGTACAGTCACAGTTGTCATGTCCAAGGTTACTTTCCCACTACAT

GGGACAGAGGTTTATTTTAGTTATAGGGAGTTACTAATAGCTTTTTTCTGCGTTTTTGTCTAAGGATTGCTAAGTTGTTTTTACCTTGGCTAGGAATATA

GCTCAGGGGTTCACGCACCTGGCTAAGGTACAGTGTTAAGTTCTGGGATCTCTAGCACTGCCTAATAAACATTCAACAAAATAAATTGTTCTTTCCTTTG

CAGAATATGTGTGTGTTTTCTATGTTTCTTTATTGTTTTAAGAAAAAAGTAAGAGAAATGGTGGTAGCACGCAGCTTTAATCCCAGTTCTTTAGACAGAG

GCAGGTGAATATTTGAGTTCCAGAACAGCTAGGGTTATACAAAATCTCTGTCTTGAAAAACAAAAAACAAACAAAAAAAAGGTAAGTG
Translation
MVGREKELSIHFVPGCCQLVE - UNI23269 - - UNI29519 - EEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHTVGCGFRRARPKFEQVNLL

DSEAVHHLIHDFQVWACMSAVVMCSLRTCLAYTESVCLVWLREVVLESCDPLSHHNAECPCVACCGVVLGVEARGSRACWQVFCPRAGSSSLSSTACGEA

WLVLMQYFPCDACREVLGCCLGTGWGLGGGGNISALMLRKYDQGNFSNLFAVT
Transcript ENSMUST00000040167
Sequence
CTGGGCCTAGGGGAGGAGGGCCAAGGGCGCGGGCGCTGCGGCCCCTGGCAGTGCTGCGCTAGTGGAGCTTGCGGTCGCGACTGAAGCGGCGCAAAGACTG

CGGGCATGGTGGGCCGGGAGAAGGAGCTCTCCATCCACTTCGTCCCCGGCTGCTGCCAGCTGGTGGAG - UNI23269 - - UNI29519 - GAGGA

AGTGAACATCCCTAGCCGGCGGGTTCTCATTACTGGTGCCACTGGGCTTCTTGGCAGAGCAGTTTACAAAGAGTTTCAGCAGAGCAACTGGCACACCGTT

GGCTGTGGCTTTCGAAGAGCAAGACCAAAATTCGAACAAGTGAACCTGTTGGATTCTGAAGCTGTTCATCACCTCATTCATGATTTCCAG - UNI2326

9 - - UNI25055 - - UNI29519 - CCTCATGTCATAGTGCATTGTGCTGCAGAGAGAAGACCTGATGTTGTTGAGAGTCAGCCAGATGCTGCTT

CCCAGCTGAATGTGGGTGCCTCTGGGAACTTGGCAAAGGAGGCAG - UNI6515 - CTGCGATTGGAGCATTTCTCATCTACATTAGCTCAGATTATG

TGTTTGATGGCACAAATCCCCCTTACACAGAAGAAGATATACCAAGTCCCCTGAATCTATATGGAAAAACAAAATTAGATGGAGAAAAAGCAGTCCTGGA

GAATAATTTAG GGGCTGCTGTGTTGAGAATTCCTGTTCTGTATGGGGAAGTTGAAAAGCTTGAAGAAAGTGCTGTGACTGTTATGTTCGACAAGGTGCA

GTTCAGCAACAAGTCAGCAAACATGGACCATTGGCAGCAGAGGTTCCCCACACATGTGAAAGACGTAGCCAGTGTGTGCCGGCAGCTGGCAGAGAAGAGG

ATGCTG GATCCATCCATTAAGGGAACCTTTCACTGGTCTGGCAATGAGCAGATGACCAAGTATGAAATGGCGTGTGCAATTGCAGATGCCTTCAACCTC

CCCAGCAGCCACTTAAGACCT ATTACTGACAGTCCTGTCATAGGAGCACAGCGCCCCAAAAATGCTCAGCTCGATTGCTCCAAATTGGAGACGTTGGGC

ATTGGCCAGAGGACACCATTTCGAACTGGAATCAAAGAATCTCTCTGGCCTTTCCTCATCGACAAGAGATGGAGACAGACTGTCTTTCATTAGCTCATGT

GTTGTGTATTTTTTTAAATGAAAAGTATAGTATGTGGCACTTTTTCAAGAATAAAGGAAATAGTTTTGTATGAGTACTCCTTAATTGTGACACATGATCC

TTCAGGTAAACAATGCTGTTGCACTAGGGGAATGTTGGACCGGCTGAGAGCGGTCATGACTTTCTGTGGATTGTTTTGTTTTGTCTGGCTTACCTCGCTA

TACAAGTAATGTAAATTATGATCTGTAATGTCCGAGGGCGGGATGAAACAGACTGTTAGACTTTGGATGAAATGCATTGTTCATTCCTACAGCTTCCTTT

CTTGCTGTTGTTTTGTTTGTTGGCTCTTGTATATTGATAGCTTCAGTGTGTGTAGAATCTCATGATAATCATCGGTGTTCATTACTTGCTTTGCTTGAGC

CCAGATCAAAATGCTTGGAGAAAAGAAAACTTTATTTTTGCAACTGTAAGTATGGTTTTTAAACGCTTGATTCTTTAATGTGTTATGTATATCAGAACCT

GTATAGCCTGATGCCTACTTCATAGCACTGTGTGGCAAACACTTGAGAGAGTGCACGTGTGTGTATTTTTTTAATATAAATACATATATATGTCTCTTTC

CTTCTATCTTACTAAGTGATGTTTCATACATGTGGTTATAATAATGAGCCTTGTAAGTCTTTTGACCACTTCTAAATAATAATAAATACTTGCTAGCATG

T
Translation
MVGREKELSIHFVPGCCQLVE - UNI23269 - - UNI29519 - EEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHTVGCGFRRARPKFEQVNLL

DSEAVHHLIHDFQ - UNI23269 - - UNI25055 - - UNI29519 - PHVIVHCAAERRPDVVESQPDAASQLNVGASGNLAKEAA - UNI65

15 - AAIGAFLIYISSDYVFDGTNPPYTEEDIPSPLNLYGKTKLDGEKAVLENNLG GAAVLRIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQ

QRFPTHVKDVASVCRQLAEKRML DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRP ITDSPVIGAQRPKNAQLDCSKLETLGIGQRTPFRTGI

KESLWPFLIDKRWRQTVFH
Transcript ENSMUST00000101347
Sequence
ATGCCGGAGGCCATGGAACAG - UNI4851 - - UNI23269 - - UNI29519 - GAGGAAGTGAACATCCCTAGCCGGCGGGTTCTCATTACTG

GTGCCACTGGGCTTCTTGGCAGAGCAGTTTACAAAGAGTTTCAGCAGAGCAACTGGCACACCGTTGGCTGTGGCTTTCGAAGAGCAAGACCAAAATTCGA

ACAAGTGAACCTGTTGGATTCTGAAGCTGTTCATCACCTCATTCATGATTTCCAG - UNI23269 - - UNI25055 - - UNI29519 - CCTCA

TGTCATAGTGCATTGTGCTGCAGAGAGAAGACCTGATGTTGTTGAGAGTCAGCCAGATGCTGCTTCCCAGCTGAATGTGGGTGCCTCTGGGAACTTGGCA

AAGGAGGCAG - UNI6515 - CTGCGATTGGAGCATTTCTCATCTACATTAGCTCAGATTATGTGTTTGATGGCACAAATCCCCCTTACACAGAAGAA

GATATACCAAGTCCCCTGAATCTATATGGAAAAACAAAATTAGATGGAGAAAAAGCAGTCCTGGAGAATAATTTAG GGGCTGCTGTGTTGAGAATTCCT

GTTCTGTATGGGGAAGTTGAAAAGCTTGAAGAAAGTGCTGTGACTGTTATGTTCGACAAGGTGCAGTTCAGCAACAAGTCAGCAAACATGGACCATTGGC

AGCAGAGGTTCCCCACACATGTGAAAGACGTAGCCAGTGTGTGCCGGCAGCTGGCAGAGAAGAGGATGCTG GATCCATCCATTAAGGGAACCTTTCACT

GGTCTGGCAATGAGCAGATGACCAAGTATGAAATGGCGTGTGCAATTGCAGATGCCTTCAACCTCCCCAGCAGCCACTTAAGACCT ATTACTGACAGTC

CTGTCATAGGAGCACAGCGCCCCAAAAATGCTCAGCTCGATTGCTCCAAATTGGAGACGTTGGGCATTGGCCAGAGGACACCATTTCGAACTGGAATCAA

AGAATCTCTCTGGCCTTTCCTCATCGACAAGAGATGGAGACAGACTGTCTTTCATTAGCTCATGTGTTGTGTATTTTTTTAAATGAAAAGTATAGTATGT

GGCACTTTTTCAAGAATAAAGGAAATAGTTTTGTATGAGTACTCCTTAATTGTGACACATGATCCTTCAGGTAAACAATGCTGTTGCACTAGGGGAATGT

TGGACCGGCTGAGAGCGGTCATGACTTTCTGTGGATTGTTTTGTTTTGTCTGGCTTACCTCGCTATACAAGTAATGTAAATTATGATCTGTAATGTCCGA

GGGCGGGATGAAACAGACTGTTAGACTTTGGATGAAATGCATTGTTCATTCCTACAGCTTCCTTTCTTGCTGTTGTTTTGTTTGTTGGCTCTTGTATATT

GATAGCTTCAGTGTGTGTAGAATCTCATGATAATCATCGGTGTTCATTACTTGCTTTGCTTGAGCCCAGATCAAAATGCTTGGAGAAAAGAAAACTTTAT

TTTTGCAACTGTAAGTATGGTTTTTAAACGCTTGATTCTTTAATGTGTTATGTATATCAGAACCTGTATAGCCTGATGCCTACTTCATAGCACTGTGTGG

CAAACACTTGAGAGAGTGCACGTGTGTGTATTTTTTTAATATAAATACATATATATGTCTCTTTCCTTCTATCTTACTAAGTGATGTTTCATACATGTGG

TTATAATAATGAGCCTTGTAAGTCTTTTGACCACTTCTAAATAATAATAAATACTTGCTAGCATGT
Translation
MPEAMEQ - UNI4851 - - UNI23269 - - UNI29519 - EEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHTVGCGFRRARPKFEQVNLLDS

EAVHHLIHDFQ - UNI23269 - - UNI25055 - - UNI29519 - PHVIVHCAAERRPDVVESQPDAASQLNVGASGNLAKEAA - UNI6515

 - AAIGAFLIYISSDYVFDGTNPPYTEEDIPSPLNLYGKTKLDGEKAVLENNLG GAAVLRIPVLYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQR

FPTHVKDVASVCRQLAEKRML DPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRP ITDSPVIGAQRPKNAQLDCSKLETLGIGQRTPFRTGIKE

SLWPFLIDKRWRQTVFH

For any suggestions or comments, please send an email to unitrap@crg.es