Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042035 (Igsf3)
Chromosomal location
Chr 3: 101181048 - 101264773 (+)
Description
immunoglobulin superfamily, member 3 Gene [Source:MGI Symbol;Acc:MGI:1926158]
RefSeq_dna
NM_207205 
RefSeq_peptide
NP_997088.2 
UniGene
Mm.257997 
MGI
MGI:1926158 
Uniprot/SWISSPROT
Q6ZQA6 
Human Ortholog
ENSG00000143061 (IGSF3)
Omim not available
UniTrap UNI11370
Vector Insertion
Chr 3: 101182416 - 101229373
Public Clones G020A12 (ggtc) FHCRC-GT-S18-5D1 (fhcrc) IST14899D3 (tigm) IST13117H3 (tigm)
IST10946H5 (tigm) IST10035A7 (tigm) IST14022H10 (tigm) IST14053H10 (tigm)
IST14906B6 (tigm) IST14253H1 (tigm) IST15085D12 (tigm) IST12956E9 (tigm)
IST14494B5 (tigm) IST14644D9 (tigm) IST11001B4 (tigm) IST11113E7 (tigm)
IST10571C9 (tigm) IST14676E2 (tigm) IST10704F2 (tigm) IST12343C9 (tigm)
IST12492E4 (tigm) IST12363C11 (tigm) IST13882E12 (tigm) IST12344E7 (tigm)
Private Clones OST472659 (lexicon) OST46970 (lexicon) OST29583 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37955
Vector Insertion
Chr 3: 101239656 - 101243297
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38515
Vector Insertion
Chr 3: 101243703 - 101254806
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000043983
Sequence
GCCGTGCGTCTTGGGAGGCGTGCGGGACACAGGACCGGCGAGCGTTCGGTTGCTGGGAGCTGCGGGGCCCCGGGCGAG GAATCTGCGGGCTTTTGTGGG

ACCACTCTCGAGCTATCAAATGCCAGCTTACTTCGTGTGCCCTGGGAGGTTCTGGGGCAGGTGACGGTACCGTGACCTCTCACTATGGATGGAGATGGAC

TTTTTGATGAAGAAATCCGAAGTGTCTTTACCAATCCGGGTGTTTTGGCTGTCTTGGGTTTTGACAAAACCTGCCTGGTTCCCTTTGGGGGATCCGAATG

AGCGATCTCAGACACCTTCACTGCGAAGCCAAGGACATTTCTGTATAATCAGCGCATGAAAGGATTTTCTCAGACTCTTTCCTCCCGTTTTCCTCGAGGA

TTAATCCACCAGAATCCATAGTTCCGGTGGAGTCTGCAAGGCATATACAATGTGGCAGAAACCTTGAGCGCCTTCGGAATTGCTCTGGCCCCTGCCTTAG

GCATAGAGGACTCTATTGCACACGCCACGCCACTCCCCTCCCCTGCCCCCAACTCCCTCCTTCTGACTACTCTGTCTTTGACTGGCTCTCATTTTCCCTG

TGAAGTTCTGTTTCCAAACTGTTCCCTGGAGCTATAAGTGGATTGGCAGTAATGAGAGATTAGGCGGTGGGAAAAGCACGGTGCCCTGTGCAGTGTCCTT

TTCCTGCTGCCGCTGCCGCCGACATGAAGTGCTTTTTCCCAGTGTTGAGCTGTCTGGCTGTGCTGG - UNI11370 - GTGTGGTGTCAGCGCAGCGA

CAGGTCACCGTCCAGGAAGGGCCCTTGTACCGCACAGAGAGCTCCCACATCACCATCTGGTGCAACGTGAGTGGCTACCAGGGTCCCTCTGAGCAGAACT

TCCAGTGGTCCATTTACCTGCCCTCTGCTCCTGAGCGTGAAGTACAGATCGTTAGCACGGTGGACTCTTCCTTCCCGTACGCCATCTACACCCAGCGAGT

CCGCGGTGGGAAGATCTACGTGGAGAGGATCCAGGGCAACTCAGCCTTACTTCACATCACAGACCTGCAAGCCCGGGATGCCGGCGAGTATGAATGTCAC

ACCCCCAACACCGATGAGCGCTACTTTGGGAGTTACAGTGCCAAGATGAACCTAGTGG TGATCCCAGATTCTCTGCAGACCACGGCTGTCCCCCAGACA

CTGCACAAAGTGGAACAGGATCCCCTGGAGCTCAGCTGCGAAGTGGCCACCGAGACCGTCCAGCACACCCACCTCTCGGTATCCTGGCTGCGGCAGAAGG

GTGGCGAGAACCCTGTGGAGGTCATTTCCCTGAGCCGAGACTTCATCCTGCACTCCAGCAGCGAATATGCCCAGAGGCAGAGCCTGGGCGAGGTGCGGCT

GGACAAGCTGGGGAGAAGCACCTTTCGTCTCACCATCTTCCACCTGCAGCCTTCCGACCAGGGCGAGTTCTACTGCGAGGCTGCGGAGTGGATCCAGGAT

CCAGATGGCTCTTGGTACGCCATGACCAGGAAGCGCTCCGAGGGTGCCGTGGTCAACGTCCAGCCCACTG ACAAAGAGTTCACCGTGCGTCTGGAAACA

GATAAGAGGCTGCACACGGTGGGTGAGCCGGTGGAGTTCAGATGTATCCTAGAGGCTCAGAACATTCCCGACCGGTACTTTGCCGTCTCCTGGGCCTTCA

ACAGCTCACTCATTGCCACCATGGGGCCTAATGCCGTGCCAGTCCTCAACAGCGATTTTGCCCACCGCGAAGCCAAGGGACAGCTTAAGGTGGCCAAAGA

GAGTGATGGTGTCTTTGTGCTGAAGATATACCACCTCCGCCAGGAAGACAGTGGCAAATACAACTGCCGGGTGACTGAGCGAGAGAAGACTGTCACTGGC

GAGTTCATAGACAAGGAGAGCAAGCGGCCCAAGAACATCCCCATCGTCGTGCTGCCCCTCA AAAGCAGCATCTCCGTGGAGGTGGCCAGCAATGCCAGT

GTCGTCCTTGAGGGAGAGGACCTGCACTTCTCCTGCACTGTCCGCACAGTGGGCAGGCTGCAGGCCCGCTTCTCGGTCATCTGGCAGCTCGTGGATAGGC

AGAACCGCCGCAGCAATGTCATGTGGCTAGACCGGGACGGCACCTTGCAGCCGGGCTCAGCGTACTGGGAGCGCAGCAGCTATGGAGGCATCCAGATGGA

GCAGGTGCAGCCCAACTCCTTCAGCCTGGGCATCTTCAACAGCAGGAAGGAAGATGAGGGCCAGTATGAGTGCCACGTGACGGAGTGGGTTCGGGCCGTA

GATGGAGAGTGGCAGATTGTGGGAGAGCGCCGCGCCAGTACCCTGGTCTCTATCACAGCCCTTG AAACGGGCTTTGCAGTCACAGCTATCTCCCGGACA

CCAGGGGTCACCTACAGCGACTCCTTTGACTTGCAGTGCATCATCAAACCCCACTACCCGGCCAGAGTCCCCGTGTCTGTGACATGGAGGTTCCAGCCAG

TGGGCACAGTGGAGTTCCATGACCTGGTGACCTTCACACGAGATGGAGGGGTTCAGTGGGGGGACAAGTCATCCACTTTCCGAACTCGGACTGCCATTGA

GAAGGCTGAGTCCAGCAACAATGTCCGCCTGAGCATCAGCCGGGCCAGTGACACAGAGGCAGGCAAGTACCAGTGCGTGGCAGAGCTGTGGCGAAGGAAT

TACAACAATACATGGACAAGGCTGGCGGAGAGGACGTCCAACCTGCTGGAGATTCGGGTGCTGCAGCCAG TGACAAAGCTCCAGGTGAGCAAGTCGAAG

AGAACGCTCACCCTGGTGGAAAACCGGGCAATTCAGCTGAACTGCTCAGTCAAGTCCCAGACCAGCCCGAACTCGCACTTCGCCGTGCTGTGGTATGTTC

ACAAACCCTCGGACGCGGACGGCAAGCTCATCCTCAAAACCACGCACAGCTCGGCCTTCGAGTACGGGACCTACGCCGAGGAGGAGGGCCTGCGAGGCCG

GCTGCAGTTCGAGAGGCATGTGTCGGGGGGCCTGTTCAGCCTCACTGTGCAGCGAGCCGAGGTCAGCGACAGCGGTAGCTACTACTGCCACGTGGAGGAG

TGGCTGCTGAGTCCCAACTATGCCTGGTACAAGCTGGCCGAGGAGGTTTCAGGGCGCACAGAGGTCACTGTGAAGCAGCCAG ACAGCCGCCTGAAGCTC

AGCCAAGTCCAGGGGAGCCTGTCTGTTCTGGAGACCCGGCAGATACAGCTGGAGTGTGTGGTCCTGAACCGCACCAGCGTGGCCTCGCAGCTCCTGGTGG

AGTGGTTTGTATGGAAGCCCAACCACCCAGAGCGAGAAGTGGTGGCCCACCTGAGCCGAGATGCTACCTTCCACTATGGCGAACAGGCTGCCAAAAACAA

CCTGAAGGGGCGGCTGCACGCGGAGAGCCCGTCCTCCGGCGTGTACAGGCTCTTCATCCAGAATGTGGCGGTACAGGACAGCGGGACCTACAGCTGCCGA

GTAGAGGAGTGGCTGCCCAGCCCCAGTGGTGTGTGGTATAAAAGGGCTGAGGACACGGCCGGACAGACAGCCGTCACAGTCATGCGACCCG ACGCTGCC

CTCCAGGTGGACACAGTGGTCCCCAATGCCACCGTAACTGAGAAGGCAGCTTTCCAACTGGACTGCAGCATCCTGTCTCGATCGAGCCAGGACTCCCGCT

TTGCTGTGGCCTGGTATTCCCTAAGGACTAAAGGTGGAGGGAAAAGAGGCAGCCTTGGCATTGACGAGCAGGAGGAAGAGGAGGAGGAGGAGGACATATC

GCAAGAAGAAGACTCTGAAGATCCGACAGAGAGGACAGTCCTGCTGAGCGTGGGACCTGATGCTGTCTTTGGTCCCGAAGGCAGTCCTTGGGAGGGCAGG

CTGCGCTTCCAGAGGCTCTCACCTCTGCTGTACCGGCTCACTGTGCTCGAGGCGAGCCCCCAGGACACAGGCAACTACTCCTGCCATGTGGAGGAGTGGC

TACCAAGCCCTCAGAAGGAATGGTACCGACTGACAGAGGAGGAGTCTGCCCCCATTGGCATCCGGGTTCTAGACACAA GTTCAACCCTGCAGTCGCTCA

TCTGCTCCAACGATGCCCTCTTCTACTTTGTCTTCTTCTACCCTTTCCCCATCTTTGGCATCCTCATCATCACCATTCTGCTGGTGCGCTTCAAAAGCCG

GAACTCCAGCAAGAACTCAGAGGGGAAGAACGGGGTGCCCCTGTTGTGGATCAAGGAGCCTCACCTGAACTACTCCCCGACTTGCCTGGAGCCTCCGGTG

CTCAGCATCCACCCGGGAGCCATTGACTAAAGAGGCTGCCCACTCCCAGCAGACGTTGCCCATGGCAGGGTCGGGTCAGGGGAGCCCTCTGGGCTTTTCC

TCATTGCTTCGTGCTCTGTGATTGGACAGGCGACAGCACCTGAACTCTGCAGTTTCTCTGCAGGAGCCAGTCAGACCTGGAACTTGTTGGAAGCTTCCGG

TCGAGGTGATGGTTGCCTCTGGGCGGCAGCCCTGGTTAGCTGATCACACCCAGGTGTCATGATGCCAACATCCTAGGTTCCTAGTTTTTGGTTTTGGTAA

CTTAGTGCGTAGCTCCAGGTGCCGCATCTACTCGCCAATCTAACTCATGTTCTCAGATCGGTGCTATGGGGTTTCCTGTGCTGTGTAATGTACTCTTTTA

AGCCCCTTGGGTCCTCTCCTTTTGGATCCCATAATGTTGTGGAAGAGTTTCTCTCACAACTGATAAGCAAGAGGAAGACGCCTTCATAGTAACAAGGATT

CTCTTCCAAGACATTTTTGTTTTTGCACATTTGAAAATGCCACCCGTGGATCAAAATATACCCAAACATTTTTTCTTTTTTTTTCTTTTTTTTTTTTTTT

TTTTTTTTACTTTCTTAGCAAGACTTGAAAAATATGTGTAGCGTGGGCCCAATTTGTATCTTATCTCTTCCTTCAGCCGGAGTTGTTGGAACCACTTTAT

AGTCAAGATGAAAGCATTGAATTTCGCTTCAAAGGACTGACTGCACATGTGCAGAAGAAACCCTGCAGGACCCTATTAGGAGCAGATGGTGGCCAGCCAA

CCAGTCCGTCAGGGAGGCAAAAAGGCTCAGTCCCATCATTGCC
Translation
 MKCFFPVLSCLAVLG - UNI11370 - GVVSAQRQVTVQEGPLYRTESSHITIWCNVSGYQGPSEQNFQWSIYLPSAPEREVQIVSTVDSSFPYAIY

TQRVRGGKIYVERIQGNSALLHITDLQARDAGEYECHTPNTDERYFGSYSAKMNLVV VIPDSLQTTAVPQTLHKVEQDPLELSCEVATETVQHTHLSVS

WLRQKGGENPVEVISLSRDFILHSSSEYAQRQSLGEVRLDKLGRSTFRLTIFHLQPSDQGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTD DKE

FTVRLETDKRLHTVGEPVEFRCILEAQNIPDRYFAVSWAFNSSLIATMGPNAVPVLNSDFAHREAKGQLKVAKESDGVFVLKIYHLRQEDSGKYNCRVTE

REKTVTGEFIDKESKRPKNIPIVVLPLK KSSISVEVASNASVVLEGEDLHFSCTVRTVGRLQARFSVIWQLVDRQNRRSNVMWLDRDGTLQPGSAYWER

SSYGGIQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVDGEWQIVGERRASTLVSITALE ETGFAVTAISRTPGVTYSDSFDLQCIIKPHYPARV

PVSVTWRFQPVGTVEFHDLVTFTRDGGVQWGDKSSTFRTRTAIEKAESSNNVRLSISRASDTEAGKYQCVAELWRRNYNNTWTRLAERTSNLLEIRVLQP

V VTKLQVSKSKRTLTLVENRAIQLNCSVKSQTSPNSHFAVLWYVHKPSDADGKLILKTTHSSAFEYGTYAEEEGLRGRLQFERHVSGGLFSLTVQRAEV

SDSGSYYCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPD DSRLKLSQVQGSLSVLETRQIQLECVVLNRTSVASQLLVEWFVWKPNHPEREVVAHLSR

DATFHYGEQAAKNNLKGRLHAESPSSGVYRLFIQNVAVQDSGTYSCRVEEWLPSPSGVWYKRAEDTAGQTAVTVMRPD DAALQVDTVVPNATVTEKAAF

QLDCSILSRSSQDSRFAVAWYSLRTKGGGKRGSLGIDEQEEEEEEEDISQEEDSEDPTERTVLLSVGPDAVFGPEGSPWEGRLRFQRLSPLLYRLTVLEA

SPQDTGNYSCHVEEWLPSPQKEWYRLTEEESAPIGIRVLDTS SSTLQSLICSNDALFYFVFFYPFPIFGILIITILLVRFKSRNSSKNSEGKNGVPLLW

IKEPHLNYSPTCLEPPVLSIHPGAID

For any suggestions or comments, please send an email to unitrap@crg.es