Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042063 (Zfp386)
Chromosomal location
Chr 12: 117285930 - 117299060 (+)
Description
zinc finger protein 386 (Kruppel-like) Gene [Source:MGI Symbol;Acc:MGI:1930708]
RefSeq_dna
NM_001004066 
RefSeq_peptide
NP_001004066.1 NP_062511.2 
UniGene
Mm.254997 Mm.467608 Mm.468049 
MGI
MGI:1930708 
Uniprot/SPTREMBL
Q9QZP7 Q1WWJ5 Q3TN43 Q99KB9 Q5DTH6 
Human Ortholog
not available
Omim not available
UniTrap UNI8210
Vector Insertion
Chr 12: 117285929 - 117286078
Public Clones RRI054 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37658
Vector Insertion
Chr 12: 117286078 - 117293180
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9403
Vector Insertion
Chr 12: 117293189 - 117293317
Public Clones XH429 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039622
Sequence
CTCTTTCAGGAGCAGTTGACCTTCCGCGACGTGGCCGTTGACTTCTCTCCGGATGAGTGGGAATGCCTGGACCCTCCTCAGCAGAGGCTGTATAGGGATG

TGATGGTAGAGAACTACAGAAACCTGGTCTCTGTGG - UNI9403 - CTCTTTCTCATCATTGTACCCAGAACTTTTCACCAGAGCAGATCCTGAAAT

ATTCCTTCACAGAAGTGACTAATGGAAGTTATAGCCTTCAGCATTTATACTTAAGGGAAGATTGTGCAAATGTAGGTGGGAATAAAGCAGCAGCCTGCCA

TGGTAGACATAAGCAATGTCTGATCACAAGCAATACCAAAGACAACAGAAATCAAGAACAGAAAACAGCTCTGAAAAAACCTCATGCAAGGACAGATACT

TTTGATGAGCCATGTGTCTATAACTGTAAATATCCACAGGAAATTTTTCAACATGACTTAACTTTGAAAGAAAGTTGGGAAGATCTGATAGATAGATTAA

TTTTT CTCAAGCAATTTCATAGACAAAGAATTAAGAAA GAGGACCGATCTCTAAAAGTGATCAAGTCGAGTCTTCCTATCCTGGAAGAGCCATACTCT

TCAGTCAGCAAATACCAGTCTCCTGTGGCCAAAAGCACAATA AATGATTGTGGATTGCCTGCTACTGATCCATTATTGCATAGCCAAAATCTAGATACA

GATATTTGGGAAACCCCTTACATGTATAAGGAAATTAGCAAAGGTTTTAGTAGTGGATCTTTACTAAATAGTTGCAATGATGTGGTTATCTTAGAGAAAT

CTGGTCAGCGTGACAAAGTACAGAATGACTTTGACCATTGCTTGAGTCCCAACAACCATCAATGTAATCTTCCAAAGAAGCTTTTCAATTGTGATAATTT

CTTTACTCAATGTTCAAAGCTTACTATCCAGCAGTGTAACTATATTCAAGATAATCATTACAAGA GTTACAGAAAA
Translation
LFQEQLTFRDVAVDFSPDEWECLDPPQQRLYRDVMVENYRNLVSVA - UNI9403 - ALSHHCTQNFSPEQILKYSFTEVTNGSYSLQHLYLREDCAN

VGGNKAAACHGRHKQCLITSNTKDNRNQEQKTALKKPHARTDTFDEPCVYNCKYPQEIFQHDLTLKESWEDLIDRLIF LKQFHRQRIKK EDRSLKVIK

SSLPILEEPYSSVSKYQSPVAKSTI NDCGLPATDPLLHSQNLDTDIWETPYMYKEISKGFSSGSLLNSCNDVVILEKSGQRDKVQNDFDHCLSPNNHQC

NLPKKLFNCDNFFTQCSKLTIQQCNYIQDNHYKS SYRK
Transcript ENSMUST00000073551
Sequence
ACAGAGCCTTGACAATATCGCGAGTCCACATCCCGTACGCGACCTTTGTGTTGGAAAATGTGAGCGTGTTTTCCAGCTTTTGGAAGCCCCGGTGGCCCTT

ACGAAATCACGGGTGCTGGAGATGCAGGAGAGCCATGGAGATG - UNI8210 - - UNI9403 - GAGCAGTTGACCTTCCGCGACGTGGCCGTTGA

CTTCTCTCCGGATGAGTGGGAATGCCTGGACCCTCCTCAGCAGAGGCTGTATAGGGATGTGATGGTAGAGAACTACAGAAACCTGGTCTCTGTGGGTGAG

GACAGCATCCCTGCAGAGCTCCCAACGCACTGCCACCATTTCATGCCTTTCCTTTCAAAAATGTCTGCCATAGCCTGTGCTTTTCATAAGCAGTACAAAC

 CTCTTTCTCATCATTGTACCCAGAACTTTTCACCAGAGCAGATCCTGAAATATTCCTTCACAGAAGTGACTAATGGAAGTTATAGCCTTCAGCATTTAT

ACTTAAGGGAAGATTGTGCAAATGTAGGTGGGAATAAAGCAGCAGCCTGCCATGGTAGACATAAGCAATGTCTGATCACAAGCAATACCAAAGACAACAG

AAATCAAGAACAGAAAACAGCTCTGAAAAAACCTCATGCAAGGACAGATACTTTTGATGAGCCATGTGTCTATAACTGTAAATATCCACAGGAAATTTTT

CAACATGACTTAACTTTGAAAGAAAGTTGGGAAGATCTGATAGATAGATTAATTTTTCACTCAAGCAATTTCATAGACAAAGAATTAAGAAACAGAGGAC

CGATCTCTAAAAGTGATCAAGTCGAGTCTTCCTATCCTGGAAGAGCCATACTCTTCAGTCAGCAAATACCAGTCTCCTGTGGCCAAAAGCACAATACTAA

TGATTGTGGATTGCCTGCTACTGATCCATTATTGCATAGCCAAAATCTAGATACAGATATTTGGGAAACCCCTTACATGTATAAGGAAATTAGCAAAGGT

TTTAGTAGTGGATCTTTACTAAATAGTTGCAATGATGTGGTTATCTTAGAGAAATCTGGTCAGCGTGACAAAGTACAGAATGACTTTGACCATTGCTTGA

GTCCCAACAACCATCAATGTAATCTTCCAAAGAAGCTTTTCAATTGTGATAATTTCTTTACTCAATGTTCAAAGCTTACTATCCAGCAGTGTAACTATAT

TCAAGATAATCATTACAAGAGTATAGATTGTGACACAATGTTTAATAAAACTTTAAACGTTACTAGGCGTAAAATTCAGCATTCCAAGAAATCCTACAAA

TGTAATGAATGTGGCAAAGCCTTTAAATATTGCTCAAGTTACAGAAAACACAGCATAATTCACACAGGAGAGAAACCCTACAAATGTAAATTATGTGGAA

AATCCTTTACCCAGTGTGCAAGCCTTAAAAAACATCAGAGAATCCACACTGGAGAGAAACCCTACAGGTGTGAAGAATGTGGCAGAAGCTTTAACCACTA

CTCAATTCTTGGTCAGCACCAGAGGATTCACACAGGAGAGAAACCCTACAAGTGTAAACAGTGTGGCAAGTCCTTTACTCAGTGTTCAAGCCTTCAGAAA

CACCAAGTAATCCACACTGGAGAGAAGCCCTACAGATGTGCAGAATGTGGCAAATCTTTTACCCAAAACTCAACACTTAGTCAACACCAGAGAATTCATA

CTGGAGAGAAACCTTACAAATGTGAAGAGTGTGGAAAGGCCTTTACCCAATGTTCAAGCCTTAGAAAACATCAGAGAATTCACACTGGAGAGAAACCCTA

CAAATGTGAAGTATGTGGCAGAGCCTTTAACTGCCGCTCATCTTTTACTAAACACAAGAGAATTCACACAGGAGAGAAACCTTACAAATGTAAAGACTGT

GACAAAGCTTTTATCCACTGCACAAATCTTATTCAACACCAGAGAATCCATACAGGAGAGAAACCATACAAATGTAATGAATGTGGGAAATCCTTTAGTC

AATGTTCAAACCTTAGAAAGCATGAGAGAATTCATACATGAAAAAAACTAGCAAATGTCAAGAATCTAGTAAATCTTTGATCCATAGTC
Translation
MEM - UNI8210 - - UNI9403 - EQLTFRDVAVDFSPDEWECLDPPQQRLYRDVMVENYRNLVSVGEDSIPAELPTHCHHFMPFLSKMSAIACAF

HKQYKP PLSHHCTQNFSPEQILKYSFTEVTNGSYSLQHLYLREDCANVGGNKAAACHGRHKQCLITSNTKDNRNQEQKTALKKPHARTDTFDEPCVYNC

KYPQEIFQHDLTLKESWEDLIDRLIFHSSNFIDKELRNRGPISKSDQVESSYPGRAILFSQQIPVSCGQKHNTNDCGLPATDPLLHSQNLDTDIWETPYM

YKEISKGFSSGSLLNSCNDVVILEKSGQRDKVQNDFDHCLSPNNHQCNLPKKLFNCDNFFTQCSKLTIQQCNYIQDNHYKSIDCDTMFNKTLNVTRRKIQ

HSKKSYKCNECGKAFKYCSSYRKHSIIHTGEKPYKCKLCGKSFTQCASLKKHQRIHTGEKPYRCEECGRSFNHYSILGQHQRIHTGEKPYKCKQCGKSFT

QCSSLQKHQVIHTGEKPYRCAECGKSFTQNSTLSQHQRIHTGEKPYKCEECGKAFTQCSSLRKHQRIHTGEKPYKCEVCGRAFNCRSSFTKHKRIHTGEK

PYKCKDCDKAFIHCTNLIQHQRIHTGEKPYKCNECGKSFSQCSNLRKHERIHT
Transcript ENSMUST00000077866
Sequence
AGTTCACAGAGCCTTGACAATATCGCGAGTCCACATCCCGTACGCGACCTTTGTGTTGGAAAATGTGAGCGTGTTTTCCAGCTTTTGGAAGCCCCGGTGG

CCCTTACGAAATCACGGGTGCTGGAGATGCAGGAGAGCCATGGAGATG - UNI8210 - - UNI9403 - GAGCAGTTGACCTTCCGCGACGTGGCC

GTTGACTTCTCTCCGGATGAGTGGGAATGCCTGGACCCTCCTCAGCAGAGGCTGTATAGGGATGTGATGGTAGAGAACTACAGAAACCTGGTCTCTGTGG

GTGAGGACAGCATCCCTGCAGAGCTCCCAACGCACTGCCACCATTTCATGCCTTTCCTTTCAAAAATGTCTGCCATAGCCTGTGCTTTTCATAAGCAGTA

CAAAC CTCTTTCTCATCATTGTACCCAGAACTTTTCACCAGAGCAGATCCTGAAATATTCCTTCACAGAAGTGACTAATGGAAGTTATAGCCTTCAGCA

TTTATACTTAAGGGAAGATTGTGCAAATGTAGGTGGGAATAAAGCAGCAGCCTGCCATGGTAGACATAAGCAATGTCTGATCACAAGCAATACCAAAGAC

AACAGAAATCAAGAACAGAAAACAGCTCTGAAAAAACCTCATGCAAGGACAGATACTTTTGATGAGCCATGTGTCTATAACTGTAAATATCCACAGGAAA

TTTTTCAACATGACTTAACTTTGAAAGAAAGTTGGGAAGATCTGATAGATAGATTAATTTTTCACTCAAGCAATTTCATAGACAAAGAATTAAGAAACAG

AGGACCGATCTCTAAAAGTGATCAAGTCGAGTCTTCCTATCCTGGAAGAGCCATACTCTTCAGTCAGCAAATACCAGTCTCCTGTGGCCAAAAGCACAAT

ACTAATGATTGTGGATTGCCTGCTACTGATCCATTATTGCATAGCCAAAATCTAGATACAGATATTTGGGAAACCCCTTACATGTATAAGGAAATTAGCA

AAGGTTTTAGTAGTGGATCTTTACTAAATAGTTGCAATGATGTGGTTATCTTAGAGAAATCTGGTCAGCGTGACAAAGTACAGAATGACTTTGACCATTG

CTTGAGTCCCAACAACCATCAATGTAATCTTCCAAAGAAGCTTTTCAATTGTGATAATTTCTTTACTCAATGTTCAAAGCTTACTATCCAGCAGTGTAAC

TATATTCAAGATAATCATTACAAGAGTATAGATTGTGACACAATGTTTAATAAAACTTTAAACGTTACTAGGCGTAAAATTCAGCATTCCAAGAAATCCT

ACAAATGTAATGAATGTGGCAAAGCCTTTAAATATTGCTCAAGTTACAGAAAACACAGCATAATTCACACAGGAGAGAAACCCTACAAATGTAAATTATG

TGGAAAATCCTTTACCCAGTGTGCAAGCCTTAAAAAACATCAGAGAATCCACACTGGAGAGAAACCCTACAGGTGTGAAGAATGTGGCAGAAGCTTTAAC

CACTACTCAATTCTTGGTCAGCACCAGAGGATTCACACAGGAGAGAAACCCTACAAGTGTAAACAGTGTGGCAAGTCCTTTACTCAGTGTTCAAGCCTTC

AGAAACACCAAGTAATCCACACTGGAGAGAAGCCCTACAGATGTGCAGAATGTGGCAAATCTTTTACCCAAAACTCAACACTTAGTCAACACCAGAGAAT

TCATACTGGAGAGAAACCTTACAAATGTGAAGAGTGTGGAAAGGCCTTTACCCAATGTTCAAGCCTTAGAAAACATCAGAGAATTCACACTGGAGAGAAA

CCCTACAAATGTGAAGTATGTGGCAGAGCCTTTAACTGCCGCTCATCTTTTACTAAACACAAGAGAATTCACACAGGAGAGAAACCTTACAAATGTAAAG

ACTGTGACAAAGCTTTTATCCACTGCACAAATCTTATTCAACACCAGAGAATCCATACAGGAGAGAAACCATACAAATGTAATGAATGTGGGAAATCCTT

TAGTCAATGTTCAAACCTTAGAAAGCATGAGAGAATTCATACATGAAAAAAACTAGCAAATGTCAAGAATCTAGTAAATCTTTGATCCATAGTC
Translation
VHRALTISRVHIPYATFVLENVSVFSSFWKPRWPLRNHGCWRCRRAMEM - UNI8210 - - UNI9403 - EQLTFRDVAVDFSPDEWECLDPPQQR

LYRDVMVENYRNLVSVGEDSIPAELPTHCHHFMPFLSKMSAIACAFHKQYKP PLSHHCTQNFSPEQILKYSFTEVTNGSYSLQHLYLREDCANVGGNKA

AACHGRHKQCLITSNTKDNRNQEQKTALKKPHARTDTFDEPCVYNCKYPQEIFQHDLTLKESWEDLIDRLIFHSSNFIDKELRNRGPISKSDQVESSYPG

RAILFSQQIPVSCGQKHNTNDCGLPATDPLLHSQNLDTDIWETPYMYKEISKGFSSGSLLNSCNDVVILEKSGQRDKVQNDFDHCLSPNNHQCNLPKKLF

NCDNFFTQCSKLTIQQCNYIQDNHYKSIDCDTMFNKTLNVTRRKIQHSKKSYKCNECGKAFKYCSSYRKHSIIHTGEKPYKCKLCGKSFTQCASLKKHQR

IHTGEKPYRCEECGRSFNHYSILGQHQRIHTGEKPYKCKQCGKSFTQCSSLQKHQVIHTGEKPYRCAECGKSFTQNSTLSQHQRIHTGEKPYKCEECGKA

FTQCSSLRKHQRIHTGEKPYKCEVCGRAFNCRSSFTKHKRIHTGEKPYKCKDCDKAFIHCTNLIQHQRIHTGEKPYKCNECGKSFSQCSNLRKHERIHT

For any suggestions or comments, please send an email to unitrap@crg.es