Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042064 (Myo3b)
Chromosomal location
Chr 2: 69877183 - 70267255 (+)
Description
myosin IIIB Gene [Source:MGI (curated);Acc:Myo3b-002]
RefSeq_dna
NM_177376 
RefSeq_peptide
NP_796350.2 
UniGene
Mm.458853 Mm.99648 
MGI
MGI:2448580 
Uniprot/SWISSPROT
Q1EG27 
Uniprot/SPTREMBL
A2AR19 Q8C9Z9 Q0P645 
Human Ortholog
ENSG00000071909 (MYO3B)
Omim not available
UniTrap UNI37574
Vector Insertion
Chr 2: 70096150 - 70119209
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30019
Vector Insertion
Chr 2: 70188053 - 70263629
Public Clones D152H02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060208
Sequence
ATCTCTGGGCCGCTTGAACAATGGCAG CAGCCTCGGAGGTGAGCGGTGAGCACACAGGAGACAAAACCGG GAAGCACCTGTATGGATTATTTCACTAT

AACCCCATGATGCTTGGCCTGGAATCACTCCCCGATCCCATGGAGACCTGGGAGATTATAGAGACGATTGGCAAAGGCACTTATGGCAAGGTCTACAAGG

TAGCCAACAAGAGAGATGGGAGCCTGGCTGCCGTGAAGGTTCTGGACCCCGTCAGT GATATGGATGAGGAGATTGAGGCTGAATACAACATTCTGCAGT

TTCTCCCCAGCCATCCCAACGTTGTAAAGTTTTATGGGATGTTTTACAAAGCCGATCGCTGTGTGGGAGGACAGCTATGGCTGGTTCTGGAG CTGTGTA

ATGGGGGCTCTGTCACTGAGCTTGTCAAGGGCCTTCTGAGGTGCGGCAAGAGGCTGGACGAAGCTGTGATTTCCTACATTCTGTATGGAGCCCTCTTG G

GCCTTCAGCATTTGCACTGCCACCGAATCATCCACCGAGATGTGAAGGGGAATAACATTCTTCTGACGACAGAAGGAGGAGTTAAGCTCGTTGACTTTG 

GTGTCTCTGCTCAACTTACAAGCACACGGCTGCGGAGAAACACATCAGTTGGGACCCCATTCTGGATGGCTCCTGAG GTCATTGCTTGCGAGCAGCAGT

ATGACTCGTCCTATGACGCTCGTTGTGACGTCTGGTCCTTGGGCATCACAGCCATTGAGCTGGGAGATGGAGACCCTCCCCTCTTTGAAATGCATCCTGT

GAAAATGCTCTTTAAGATACCAAG AAACCCTCCACCCACTTTGCTGCACCCTGACAGCTGGTGTGAGGAATTTAACCACTTCATTTCACA GTGTCTTA

TTAAAGATTTTGAAAAGCGGCCTTCGGTCACCCATCTCTTGGACCACCCATTCATTAAAGGAACTCAAGGCAAGGTTTTGTGTCTGCAAAAACAGCTGGC

CAAGGTGCTCCAGGACCAGAAGCATCGAAACCCTGTTGCTAAAACCAG GCATGAAAGGATGCATACTGGAAGACCCCATCGAGTAGAGGATGCCGGCAA

GTGCTGCCTTGAGGATGACCTGGTCAATCTCGAGGTCCTGGACGAG GACACGATTATCTACTGGCTGCAGAAGCGGTATGCAGATGCACTGATCTACAC

CTATGTTGGAGACATTCTAATTGCCTTAAACCCCTTCCAGAATCTAAGTATATACTCTCCACAG TTTTCCAGGCTTTATCATGGGGTGAAACGTTCCTC

GAATCCCCCCCACATATTTGCATCAGCAGACAACGCTTATCAGTGTTTGGTTACTTTCAGCAAAGACCAG TGTATTGTCATCAGTGGAGAAAGCGGATC

GGGGAAGACGGAAAGCGCCCATCTGATTGTTCAGCATCTTACTTTCTTAGGAAAG GCTGACAATCAGACCCTACGCCAGAAAATCCTCCAAGTGAACTC

CCTGGTGGAAGCCTTCGGGAACGCCCGCACAGCCATCAATGATAACTCCAGCCGCTTCGGGAAGTATCTAGAAATGATGTTCACACCAACTGGAGCTGTC

ATGGGGGCAAGAATCTCCGAGTATCTTCTTGAGAAATCCAGAGTTATACAGCAGGCAGC GGGAGAGAAAAATTTTCATATATTTTACTATATTTATGCT

GGTCTTTATCACCAAAAGAAACTCGCTGAGTTCAGACTTCCCGAGGAAAAGCCTCCTAG ATATATAGCTGGGGAAACTGAAAGAGTCATGCAGGACATC

ACCTCCAAAGAGTCTTACCGGACACAGTTTGAGGCCATTCAGCACTGCTTCAAGATTATTGGATTCGCTGACAAG GAGGTACACTCTGTGTACAGAATT

CTGGCGGGGATTTTGAATATTGGCAGCATTGAATTCGCAGCTATTTCCTCTCAACACCAAACTGATAAAAGTGAGGTACCTAATCCAGAAGCTCTGGAAA

ACG CTGCCTGCGTGCTCTGCATTAGCTCCGAAGAGCTTCAGGAGGCCCTCACTTCCCACTGTGTGGTCACACGAGGGGAGACCATTGTCAGAGCCAACA

CAGTGGACAGGGCTGAAGACGTCAGGGACGCCATGTCTAAGGCCCTCTATGGGAGGCTGTTCAGCTGGATTGTGAATCGAATCAACACACTCCTGCAGCC

AGATAAAAACATATG TAGTGCAGAGGACAGGATGAATGTGGGCATCTTGGACATTTTTGGCTTTGAGGATTTCCAGAGGAATTCCTTTGAACAGCTCTG

CATAAATATTGCCAATGAACAGATCCAGTACTACTTCAATCAGCATGTGTTTGCTCTTGAGCAG ATGGAGTACAAGAATGAAGGTGTCGATGCTGTCCT

CGTGCAGTATGAAGACAATCGCCCACTCCTGGACATGTTCCTCCAAAAACCCTTGGGCCTTCTGGCACTTCTGGATGAAGAAAGTCGATTTCCCCAAGGG

ACAGACCAGACCTTGGTTG ATAAATTTGAAGACAACCTACGGTGTAAGTTCTTCTGGAGGCCCAAAGGTGTGGAACTCTGTTTTGGCATTCAGCACTAT

GCTGGACCG GTGTTATACGATGCTTCTGGGGTTCTTGAGAAAAACAGAGACACCCTCCCTGCTGACGTGGTGGTAGTCCTGAGGACGTCTGAGAACAAA

CTCCTTCAGCAACTGTTCTCAATTCCTTTGACCAAAACAG GTAATTTGGCACAAACCAGAGCTAAGATCACAGCATCCTCGAGATCTTTGCCTCCACAT

TTCAGTGCTGGGAGGGCCAAG GTAGACACCCTGGAGGTGATTCGACATCCAGAAGAAACCACCAACATGAAGAGACAAACCATGGCTTCTTACTTCCGG

 TATTCTCTGATGGACCTGCTCTCCAAAATGGTGGTCGGACAGCCTCACTTTATTCGTTGCATTAAGCCTAATGATGACCGCAAGGCCCTGCAGTTCTCC

CAAGACAGAGTCTTGGCCCAGCTTCGCTCCACGGGCATCCTGGAGACCGTCAGCATCCGCAGGCAGGGCTACTCCCATCGCATCTTCTTTGAAGAGTTTG

TTAAAAG GTATTATTACTTGGCATTCCGAGCACATCAAACACCTCCTGCTAACAAAGAGAGCTGTGTTGCTATCTTGGAAAAGTCCAGATTAGATCACT

GGGTCCTGGGGAAAACAAAG GTTTTCCTCAAATATTACCATGTCGAGCAATTAAATTTGCTTCTGCGAGAAGTCATGGGACGAGTGGTCATGCTGCAGG

CATATACCAAGGGCTGGCTCGGAGCAAGGAGATACAAGAGAGCCAAAGAGAAGAGAGAGAAGGGCGCCATCACCATCCAGTCAG CCTGGAGAGGCTATG

ATGCTCGGAGGAAATTGAAGCAAAGAAGCCGGAGGAGGAGTGAGTCCGAGGCTCACATTCACACAG TTCTCCAAACCACTCCTGATCAGAAATACTGTC

CAGATTCAGGAGGAGAGTCCAACAGAGGTCATGAAGAGACGTCAAGGAACTGCCCCGCTGAAGCCGACACAGATGG GCACCCACAAGCCCAGAGTCCCC

CAACAGGCTGTGATGTCACCTCAGGACATGCAGATACAGCAGCTGGGTATACTGTTGCTGAG CTCTCAGTTGCTGGAACCGATGTGTCACCTTCTCTGG

TGTACCACACTGCCTCAGCTCACCAAAGACTGAGCCCCTGTGAAGACTCTCTCAAACCTG - UNI30019 - GTTCCGAAGAAGGTCTCTCCCAGAAG

CAGCGAGCACCTCGCAGACGGTGTCAGCAGCCCAAAATGTTGAGTAGCCCCGAGGACACCATGTACTATAACCAGTTAAAT GGAACTCTAGAATATCAA

GGGAGCCAGAGGAAGCCAAGAAAACTTGG ACAAATCAAAGTGCTGGATGGGGAGGACCAGTATTACAAATGCCTGTCCCCTGGGGCCTGTGCCCCTGAG

GAAACCCACTCAGTCCACCCTTTCTTCTTCTCCTCGTCACCCAGAGAAGACCCCTTTGCTCAACACTGAGTTGCCCTTTCCAGCCCCGGTGTGCCCCAGG

TAAAAGCAGCCATGGTAACTGACCATCTAAGAGGAAGGCACTGTTCTGAGGTCAGCTTCTTTGGACACAATCTGGGCCCTAAACCTTGCTGAACAACTCA

ACAGATTCCTGAAAATGCTGTCTCTTATTCCCCTTCACCTGCCCTGCAGCCTGAGTCACAGAACCCGTGTTCCCTTCATCCCTTGAGAACACCTCTGCTG

GGGTAATTCAGCCTTTTAGGCACCCGGCAGCTAAGAAGAGGGAGGACAGACCCACCACAGGCCAGTCGTGAAATCAGATAAGATGCCTAGTTTCCCCAAG

TGGAATCCTGCTGGATTGCTATCTCCCTTCTACCCTTTTCTACCAGTCCCCCATTTGCTAGGCTTTTCTACATCTCCCCTTGGGTCAGGGTTTCATTGCT

GAGGATATTGTTTCCAGGAAGAGTGGCCATGGTTTATGCTTAGAAAGAAAACTCAACATCTTTCAGATGCTCTCTCCATGTCAAAATGAATGCCTGTTGC

ACATTGTCATGTTGAGAAGACTTTGCCAGATTATTCTACCTTACCAAGAGAACCCAGTCACACCAGCAATGAAAAGGAGGAGAATTGGGGCCTAAGTGAT

ACCTGATTTTGTATCTGCATTCCCTGGCCAGCTGGCTCCACAGGATGTGAGAGGCGGCAGAAGAGAGATCCCCACTTGTCCATCTCTGTGTTCCTCAGAC

CTAGCTCAGAGCCTAGGAGAGTGGGCACCCAGGGCATAAAAAGGAATGGAGAGATTGCATTATCTGCAGCAGCATGGCTGGCAGGCAGTTCCTTGCGGTG

ATATGTGATCTATGAGTAACCACCTTTCTCACAGATAAGTTCAAGGTTGAGCTGTTCCTATTTCATGACATTATATGCCGTCATACTCTATACAGTTCAG

TACAAGCAGCTTTCTTGAGCACATACCTGTGAGAACAAAACAAGATGGAAGGTTGCTATGTGCTGTGACAGTGAGTCCGCGTGAAGACTCCTCTAGAGCA

GATGTTCTTAATATTTTCTTTCTCTAAAATACTTTGTTGATTTCAGAAAAATACTTTAAAATATAGAAAAAGTTACTATTGTCAGGGTTTGTTTTGTTTT

GTTTTGTTTTCCTTTAACGGAGGGCACAAGCAAATATACTCTGAACAGAAACAATTAAGTGAGGTTGGTGTGCTCACTTTTCCCATGGAGGTGTGGGACA

ACCTCTATACACACCAAGTAAGACACCCGTGACAGACAGAA
Translation
MAA AASEVSGEHTGDKTG GKHLYGLFHYNPMMLGLESLPDPMETWEIIETIGKGTYGKVYKVANKRDGSLAAVKVLDPVS DMDEEIEAEYNILQFLP

SHPNVVKFYGMFYKADRCVGGQLWLVLE LCNGGSVTELVKGLLRCGKRLDEAVISYILYGALL GLQHLHCHRIIHRDVKGNNILLTTEGGVKLVDFG 

GVSAQLTSTRLRRNTSVGTPFWMAPE VIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPR RNPPPTLLHPDSWCEEFNHFISQ

 QCLIKDFEKRPSVTHLLDHPFIKGTQGKVLCLQKQLAKVLQDQKHRNPVAKTR RHERMHTGRPHRVEDAGKCCLEDDLVNLEVLDE DTIIYWLQKRY

ADALIYTYVGDILIALNPFQNLSIYSPQ FSRLYHGVKRSSNPPHIFASADNAYQCLVTFSKDQ CIVISGESGSGKTESAHLIVQHLTFLGK ADNQTL

RQKILQVNSLVEAFGNARTAINDNSSRFGKYLEMMFTPTGAVMGARISEYLLEKSRVIQQAA AGEKNFHIFYYIYAGLYHQKKLAEFRLPEEKPPR RY

IAGETERVMQDITSKESYRTQFEAIQHCFKIIGFADK EVHSVYRILAGILNIGSIEFAAISSQHQTDKSEVPNPEALENA AACVLCISSEELQEALTS

HCVVTRGETIVRANTVDRAEDVRDAMSKALYGRLFSWIVNRINTLLQPDKNIC CSAEDRMNVGILDIFGFEDFQRNSFEQLCINIANEQIQYYFNQHVF

ALEQ MEYKNEGVDAVLVQYEDNRPLLDMFLQKPLGLLALLDEESRFPQGTDQTLVD DKFEDNLRCKFFWRPKGVELCFGIQHYAGP VLYDASGVLEK

NRDTLPADVVVVLRTSENKLLQQLFSIPLTKTG GNLAQTRAKITASSRSLPPHFSAGRAK VDTLEVIRHPEETTNMKRQTMASYFR YSLMDLLSKMV

VGQPHFIRCIKPNDDRKALQFSQDRVLAQLRSTGILETVSIRRQGYSHRIFFEEFVKR RYYYLAFRAHQTPPANKESCVAILEKSRLDHWVLGKTK VF

LKYYHVEQLNLLLREVMGRVVMLQAYTKGWLGARRYKRAKEKREKGAITIQSA AWRGYDARRKLKQRSRRRSESEAHIHTV VLQTTPDQKYCPDSGGE

SNRGHEETSRNCPAEADTDG GHPQAQSPPTGCDVTSGHADTAAGYTVAE LSVAGTDVSPSLVYHTASAHQRLSPCEDSLKPG - UNI30019 - GS

EEGLSQKQRAPRRRCQQPKMLSSPEDTMYYNQLN GTLEYQGSQRKPRKLG GQIKVLDGEDQYYKCLSPGACAPEETHSVHPFFFSSSPREDPFAQH
Transcript ENSMUST00000100044
Sequence
ATCTCTGGGCCGCTTGAACAATGGCAG CAGCCTCGGAGGTGAGCGGTGAGCACACAGGAGACAAAACCGG GAAGCACCTGTATGGATTATTTCACTAT

AACCCCATGATGCTTGGCCTGGAATCACTCCCCGATCCCATGGAGACCTGGGAGATTATAGAGACGATTGGCAAAGGCACTTATGGCAAGGTCTACAAGG

TAGCCAACAAGAGAGATGGGAGCCTGGCTGCCGTGAAGGTTCTGGACCCCGTCAGT GATATGGATGAGGAGATTGAGGCTGAATACAACATTCTGCAGT

TTCTCCCCAGCCATCCCAACGTTGTAAAGTTTTATGGGATGTTTTACAAAGCCGATCGCTGTGTGGGAGGACAGCTATGGCTGGTTCTGGAG CTGTGTA

ATGGGGGCTCTGTCACTGAGCTTGTCAAGGGCCTTCTGAGGTGCGGCAAGAGGCTGGACGAAGCTGTGATTTCCTACATTCTGTATGGAGCCCTCTTG G

GCCTTCAGCATTTGCACTGCCACCGAATCATCCACCGAGATGTGAAGGGGAATAACATTCTTCTGACGACAGAAGGAGGAGTTAAGCTCGTTGACTTTG 

GTGTCTCTGCTCAACTTACAAGCACACGGCTGCGGAGAAACACATCAGTTGGGACCCCATTCTGGATGGCTCCTGAG GTCATTGCTTGCGAGCAGCAGT

ATGACTCGTCCTATGACGCTCGTTGTGACGTCTGGTCCTTGGGCATCACAGCCATTGAGCTGGGAGATGGAGACCCTCCCCTCTTTGAAATGCATCCTGT

GAAAATGCTCTTTAAGATACCAAG AAACCCTCCACCCACTTTGCTGCACCCTGACAGCTGGTGTGAGGAATTTAACCACTTCATTTCACA GTGTCTTA

TTAAAGATTTTGAAAAGCGGCCTTCGGTCACCCATCTCTTGGACCACCCATTCATTAAAGGAACTCAAGGCAAGGTTTTGTGTCTGCAAAAACAGCTGGC

CAAGGTGCTCCAGGACCAGAAGCATCGAAACCCTGTTGCTAAAACCAG GCATGAAAGGATGCATACTGGAAGACCCCATCGAGTAGAGGATGCCGGCAA

GTGCTGCCTTGAGGATGACCTGGTCAATCTCGAGGTCCTGGACGAG GACACGATTATCTACTGGCTGCAGAAGCGGTATGCAGATGCACTGATCTACAC

CTATGTTGGAGACATTCTAATTGCCTTAAACCCCTTCCAGAATCTAAGTATATACTCTCCACAG TTTTCCAGGCTTTATCATGGGGTGAAACGTTCCTC

GAATCCCCCCCACATATTTGCATCAGCAGACAACGCTTATCAGTGTTTGGTTACTTTCAGCAAAGACCAG TGTATTGTCATCAGTGGAGAAAGCGGATC

GGGGAAGACGGAAAGCGCCCATCTGATTGTTCAGCATCTTACTTTCTTAGGAAAG GCTGACAATCAGACCCTACGCCAGAAAATCCTCCAAGTGAACTC

CCTGGTGGAAGCCTTCGGGAACGCCCGCACAGCCATCAATGATAACTCCAGCCGCTTCGGGAAGTATCTAGAAATGATGTTCACACCAACTGGAGCTGTC

ATGGGGGCAAGAATCTCCGAGTATCTTCTTGAGAAATCCAGAGTTATACAGCAGGCAGC GGGAGAGAAAAATTTTCATATATTTTACTATATTTATGCT

GGTCTTTATCACCAAAAGAAACTCGCTGAGTTCAGACTTCCCGAGGAAAAGCCTCCTAG ATATATAGCTGGGGAAACTGAAAGAGTCATGCAGGACATC

ACCTCCAAAGAGTCTTACCGGACACAGTTTGAGGCCATTCAGCACTGCTTCAAGATTATTGGATTCGCTGACAAG GAGGTACACTCTGTGTACAGAATT

CTGGCGGGGATTTTGAATATTGGCAGCATTGAATTCGCAGCTATTTCCTCTCAACACCAAACTGATAAAAGTGAGGTACCTAATCCAGAAGCTCTGGAAA

ACG CTGCCTGCGTGCTCTGCATTAGCTCCGAAGAGCTTCAGGAGGCCCTCACTTCCCACTGTGTGGTCACACGAGGGGAGACCATTGTCAGAGCCAACA

CAGTGGACAGGGCTGAAGACGTCAGGGACGCCATGTCTAAGGCCCTCTATGGGAGGCTGTTCAGCTGGATTGTGAATCGAATCAACACACTCCTGCAGCC

AGATAAAAACATATG TAGTGCAGAGGACAGGATGAATGTGGGCATCTTGGACATTTTTGGCTTTGAGGATTTCCAGAGGAATTCCTTTGAACAGCTCTG

CATAAATATTGCCAATGAACAGATCCAGTACTACTTCAATCAGCATGTGTTTGCTCTTGAGCAG ATGGAGTACAAGAATGAAGGTGTCGATGCTGTCCT

CGTGCAGTATGAAGACAATCGCCCACTCCTGGACATGTTCCTCCAAAAACCCTTGGGCCTTCTGGCACTTCTGGATGAAGAAAGTCGATTTCCCCAAGGG

ACAGACCAGACCTTGGTTG ATAAATTTGAAGACAACCTACGGTGTAAGTTCTTCTGGAGGCCCAAAGGTGTGGAACTCTGTTTTGGCATTCAGCACTAT

GCTGGACCG GTGTTATACGATGCTTCTGGGGTTCTTGAGAAAAACAGAGACACCCTCCCTGCTGACGTGGTGGTAGTCCTGAGGACGTCTGAGAACAAA

CTCCTTCAGCAACTGTTCTCAATTCCTTTGACCAAAACAG GTAATTTGGCACAAACCAGAGCTAAGATCACAGCATCCTCGAGATCTTTGCCTCCACAT

TTCAGTGCTGGGAGGGCCAAG GTAGACACCCTGGAGGTGATTCGACATCCAGAAGAAACCACCAACATGAAGAGACAAACCATGGCTTCTTACTTCCGG

 TATTCTCTGATGGACCTGCTCTCCAAAATGGTGGTCGGACAGCCTCACTTTATTCGTTGCATTAAGCCTAATGATGACCGCAAGGCCCTGCAGTTCTCC

CAAGACAGAGTCTTGGCCCAGCTTCGCTCCACGGGCATCCTGGAGACCGTCAGCATCCGCAGGCAGGGCTACTCCCATCGCATCTTCTTTGAAGAGTTTG

TTAAAAG GTATTATTACTTGGCATTCCGAGCACATCAAACACCTCCTGCTAACAAAGAGAGCTGTGTTGCTATCTTGGAAAAGTCCAGATTAGATCACT

GGGTCCTGGGGAAAACAAAG GTTTTCCTCAAATATTACCATGTCGAGCAATTAAATTTGCTTCTGCGAGAAGTCATGGGACGAGTGGTCATGCTGCAGG

CATATACCAAGGGCTGGCTCGGAGCAAGGAGATACAAGAGAGCCAAAGAGAAGAGAGAGAAGGGCGCCATCACCATCCAGTCAG CCTGGAGAGGCTATG

ATGCTCGGAGGAAATTGAAGCAAAGAAGCCGGAGGAGGAGTGAGTCCGAGGCTCACATTCACACAG TTCTCCAAACCACTCCTGATCAGAAATACTGTC

CAGATTCAGGAGGAGAGTCCAACAGAGGTCATGAAGAGACGTCAAGGAACTGCCCCGCTGAAGCCGACACAGATGG - UNI30019 - TTCCGAAGAA

GGTCTCTCCCAGAAGCAGCGAGCACCTCGCAGACGGTGTCAGCAGCCCAAAATGTTGAGTAGCCCCGAGGACACCATGTACTATAACCAGTTAAAT GGA

ACTCTAGAATATCAAGGGAGCCAGAGGAAGCCAAGAAAACTTGG ACAAATCAAAGTGCTGGATGGGGAGGACCAGTATTACAAATGCCTGTCCCCTGGG

GCCTGTGCCCCTGAGGAAACCCACTCAGTCCACCCTTTCTTCTTCTCCTCGTCACCCAGAGAAGACCCCTTTGCTCAACACTGAGTTGCCCTTTCCAGCC

CCGGTGTGCCCCAGGTAAAAGCAGCCATGGTAACTGACCATCTAAGAGGAAGGCACTGTTCTGAGGTCAGCTTCTTTGGACACAATCTGGGCCCTAAACC

TTGCTGAACAACTCAACAGATTCCTGAAAATGCTGTCTCTTATTCCCCTTCACCTGCCCTGCAGCCTGAGTCACAGAACCCGTGTTCCCTTCATCCCTTG

AGAACACCTCTGCTGGGGTAATTCAGCCTTTTAGGCACCCGGCAGCTAAGAAGAGGGAGGACAGACCCACCACAGGCCAGTCGTGAAATCAGATAAGATG

CCTAGTTTCCCCAAGTGGAATCCTGCTGGATTGCTATCTCCCTTCTACCCTTTTCTACCAGTCCCCCATTTGCTAGGCTTTTCTACATCTCCCCTTGGGT

CAGGGTTTCATTGCTGAGGATATTGTTTCCAGGAAGAGTGGCCATGGTTTATGCTTAGAAAGAAAACTCAACATCTTTCAGATGCTCTCTCCATGTCAAA

ATGAATGCCTGTTGCACATTGTCATGTTGAGAAGACTTTGCCAGATTATTCTACCTTACCAAGAGAACCCAGTCACACCAGCAATGAAAAGGAGGAGAAT

TGGGGCCTAAGTGATACCTGATTTTGTATCTGCATTCCCTGGCCAGCTGGCTCCACAGGATGTGAGAGGCGGCAGAAGAGAGATCCCCACTTGTCCATCT

CTGTGTTCCTCAGACCTAGCTCAGAGCCTAGGAGAGTGGGCACCCAGGGCATAAAAAGGAATGGAGAGATTGCATTATCTGCAGCAGCATGGCTGGCAGG

CAGTTCCTTGCGGTGATATGTGATCTATGAGTAACCACCTTTCTCACAGATAAGTTCAAGGTTGAGCTGTTCCTATTTCATGACATTATATGCCGTCATA

CTCTATACAGTTCAGTACAAGCAGCTTTCTTGAGCACATACCTGTGAGAACAAAACAAGATGGAAGGTTGCTATGTGCTGTGACAGTGAGTCCGCGTGAA

GACTCCTCTAGAGCAGATGTTCTTAATATTTTCTTTCTCTAAAATACTTTGTTGATTTCAGAAAAATACTTTAAAATATAGAAAAAGTTACTATTGTCAG

GGTTTGTTTTGTTTTGTTTTGTTTTCCTTTAACGGAGGGCACAAGCAAATATACTCTGAACAGAAACAATTAAGTGAGGTTGGTGTGCTCACTTTTCCCA

TGGAGGTGTGGGACAACCTCTATACACACCAAGTAAGACACCCGTGACAGACAGAA
Translation
  MMLGLESLPDPMETWEIIETIGKGTYGKVYKVANKRDGSLAAVKVLDPVS DMDEEIEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLE L

CNGGSVTELVKGLLRCGKRLDEAVISYILYGALL GLQHLHCHRIIHRDVKGNNILLTTEGGVKLVDFG GVSAQLTSTRLRRNTSVGTPFWMAPE VIA

CEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPR RNPPPTLLHPDSWCEEFNHFISQ QCLIKDFEKRPSVTHLLDHPFIKGTQGKV

LCLQKQLAKVLQDQKHRNPVAKTR RHERMHTGRPHRVEDAGKCCLEDDLVNLEVLDE DTIIYWLQKRYADALIYTYVGDILIALNPFQNLSIYSPQ F

SRLYHGVKRSSNPPHIFASADNAYQCLVTFSKDQ CIVISGESGSGKTESAHLIVQHLTFLGK ADNQTLRQKILQVNSLVEAFGNARTAINDNSSRFGK

YLEMMFTPTGAVMGARISEYLLEKSRVIQQAA AGEKNFHIFYYIYAGLYHQKKLAEFRLPEEKPPR RYIAGETERVMQDITSKESYRTQFEAIQHCFK

IIGFADK EVHSVYRILAGILNIGSIEFAAISSQHQTDKSEVPNPEALENA AACVLCISSEELQEALTSHCVVTRGETIVRANTVDRAEDVRDAMSKAL

YGRLFSWIVNRINTLLQPDKNIC CSAEDRMNVGILDIFGFEDFQRNSFEQLCINIANEQIQYYFNQHVFALEQ MEYKNEGVDAVLVQYEDNRPLLDMF

LQKPLGLLALLDEESRFPQGTDQTLVD DKFEDNLRCKFFWRPKGVELCFGIQHYAGP VLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLT

KTG GNLAQTRAKITASSRSLPPHFSAGRAK VDTLEVIRHPEETTNMKRQTMASYFR YSLMDLLSKMVVGQPHFIRCIKPNDDRKALQFSQDRVLAQL

RSTGILETVSIRRQGYSHRIFFEEFVKR RYYYLAFRAHQTPPANKESCVAILEKSRLDHWVLGKTK VFLKYYHVEQLNLLLREVMGRVVMLQAYTKGW

LGARRYKRAKEKREKGAITIQSA AWRGYDARRKLKQRSRRRSESEAHIHTV VLQTTPDQKYCPDSGGESNRGHEETSRNCPAEADTDG - UNI3001

9 - GSEEGLSQKQRAPRRRCQQPKMLSSPEDTMYYNQLN GTLEYQGSQRKPRKLG GQIKVLDGEDQYYKCLSPGACAPEETHSVHPFFFSSSPREDP

FAQH
Transcript ENSMUST00000112243
Sequence
TGAAGCTAGCTTGACTTAAAACAG GAAGCACCTGTATGGATTATTTCACTATAACCCCATGATGCTTGGCCTGGAATCACTCCCCGATCCCATGGAGAC

CTGGGAGATTATAGAGACGATTGGCAAAGGCACTTATGGCAAGGTCTACAAGGTAGCCAACAAGAGAGATGGGAGCCTGGCTGCCGTGAAGGTTCTGGAC

CCCGTCAGT GATATGGATGAGGAGATTGAGGCTGAATACAACATTCTGCAGTTTCTCCCCAGCCATCCCAACGTTGTAAAGTTTTATGGGATGTTTTAC

AAAGCCGATCGCTGTGTGGGAGGACAGCTATGGCTGGTTCTGGAG CTGTGTAATGGGGGCTCTGTCACTGAGCTTGTCAAGGGCCTTCTGAGGTGCGGC

AAGAGGCTGGACGAAGCTGTGATTTCCTACATTCTGTATGGAGCCCTCTTG GGCCTTCAGCATTTGCACTGCCACCGAATCATCCACCGAGATGTGAAG

GGGAATAACATTCTTCTGACGACAGAAGGAGGAGTTAAGCTCGTTGACTTTG GTGTCTCTGCTCAACTTACAAGCACACGGCTGCGGAGAAACACATCA

GTTGGGACCCCATTCTGGATGGCTCCTGAG GTCATTGCTTGCGAGCAGCAGTATGACTCGTCCTATGACGCTCGTTGTGACGTCTGGTCCTTGGGCATC

ACAGCCATTGAGCTGGGAGATGGAGACCCTCCCCTCTTTGAAATGCATCCTGTGAAAATGCTCTTTAAGATACCAAG AAACCCTCCACCCACTTTGCTG

CACCCTGACAGCTGGTGTGAGGAATTTAACCACTTCATTTCACA GTGTCTTATTAAAGATTTTGAAAAGCGGCCTTCGGTCACCCATCTCTTGGACCAC

CCATTCATTAAAGGAACTCAAGGCAAGGTTTTGTGTCTGCAAAAACAGCTGGCCAAGGTGCTCCAGGACCAGAAGCATCGAAACCCTGTTGCTAAAACCA

G GCATGAAAGGATGCATACTGGAAGACCCCATCGAGTAGAGGATGCCGGCAAGTGCTGCCTTGAGGATGACCTGGTCAATCTCGAGGTCCTGGACGAG 

GACACGATTATCTACTGGCTGCAGAAGCGGTATGCAGATGCACTGATCTACACCTATGTTGGAGACATTCTAATTGCCTTAAACCCCTTCCAGAATCTAA

GTATATACTCTCCACAG TTTTCCAGGCTTTATCATGGGGTGAAACGTTCCTCGAATCCCCCCCACATATTTGCATCAGCAGACAACGCTTATCAGTGTT

TGGTTACTTTCAGCAAAGACCAG TGTATTGTCATCAGTGGAGAAAGCGGATCGGGGAAGACGGAAAGCGCCCATCTGATTGTTCAGCATCTTACTTTCT

TAGGAAAG GCTGACAATCAGACCCTACGCCAGAAAATCCTCCAAGTGAACTCCCTGGTGGAAGCCTTCGGGAACGCCCGCACAGCCATCAATGATAACT

CCAGCCGCTTCGGGAAGTATCTAGAAATGATGTTCACACCAACTGGAGCTGTCATGGGGGCAAGAATCTCCGAGTATCTTCTTGAGAAATCCAGAGTTAT

ACAGCAGGCAGC GGGAGAGAAAAATTTTCATATATTTTACTATATTTATGCTGGTCTTTATCACCAAAAGAAACTCGCTGAGTTCAGACTTCCCGAGGA

AAAGCCTCCTAG ATATATAGCTGGGGAAACTGAAAGAGTCATGCAGGACATCACCTCCAAAGAGTCTTACCGGACACAGTTTGAGGCCATTCAGCACTG

CTTCAAGATTATTGGATTCGCTGACAAG GAGGTACACTCTGTGTACAGAATTCTGGCGGGGATTTTGAATATTGGCAGCATTGAATTCGCAGCTATTTC

CTCTCAACACCAAACTGATAAAAGTGAGGTACCTAATCCAGAAGCTCTGGAAAACG CTGCCTGCGTGCTCTGCATTAGCTCCGAAGAGCTTCAGGAGGC

CCTCACTTCCCACTGTGTGGTCACACGAGGGGAGACCATTGTCAGAGCCAACACAGTGGACAGGGCTGAAGACGTCAGGGACGCCATGTCTAAGGCCCTC

TATGGGAGGCTGTTCAGCTGGATTGTGAATCGAATCAACACACTCCTGCAGCCAGATAAAAACATATG TAGTGCAGAGGACAGGATGAATGTGGGCATC

TTGGACATTTTTGGCTTTGAGGATTTCCAGAGGAATTCCTTTGAACAGCTCTGCATAAATATTGCCAATGAACAGATCCAGTACTACTTCAATCAGCATG

TGTTTGCTCTTGAGCAG ATGGAGTACAAGAATGAAGGTGTCGATGCTGTCCTCGTGCAGTATGAAGACAATCGCCCACTCCTGGACATGTTCCTCCAAA

AACCCTTGGGCCTTCTGGCACTTCTGGATGAAGAAAGTCGATTTCCCCAAGGGACAGACCAGACCTTGGTTG ATAAATTTGAAGACAACCTACGGTGTA

AGTTCTTCTGGAGGCCCAAAGGTGTGGAACTCTGTTTTGGCATTCAGCACTATGCTGGACCG GTGTTATACGATGCTTCTGGGGTTCTTGAGAAAAACA

GAGACACCCTCCCTGCTGACGTGGTGGTAGTCCTGAGGACGTCTGAGAACAAACTCCTTCAGCAACTGTTCTCAATTCCTTTGACCAAAACAG GTAATT

TGGCACAAACCAGAGCTAAGATCACAGCATCCTCGAGATCTTTGCCTCCACATTTCAGTGCTGGGAGGGCCAAG GTAGACACCCTGGAGGTGATTCGAC

ATCCAGAAGAAACCACCAACATGAAGAGACAAACCATGGCTTCTTACTTCCGG TATTCTCTGATGGACCTGCTCTCCAAAATGGTGGTCGGACAGCCTC

ACTTTATTCGTTGCATTAAGCCTAATGATGACCGCAAGGCCCTGCAGTTCTCCCAAGACAGAGTCTTGGCCCAGCTTCGCTCCACGGGCATCCTGGAGAC

CGTCAGCATCCGCAGGCAGGGCTACTCCCATCGCATCTTCTTTGAAGAGTTTGTTAAAAG GTATTATTACTTGGCATTCCGAGCACATCAAACACCTCC

TGCTAACAAAGAGAGCTGTGTTGCTATCTTGGAAAAGTCCAGATTAGATCACTGGGTCCTGGGGAAAACAAAG GTTTTCCTCAAATATTACCATGTCGA

GCAATTAAATTTGCTTCTGCGAGAAGTCATGGGACGAGTGGTCATGCTGCAGGCATATACCAAGGGCTGGCTCGGAGCAAGGAGATACAAGAGAGCCAAA

GAGAAGAGAGAGAAGGGCGCCATCACCATCCAGTCAG CCTGGAGAGGCTATGATGCTCGGAGGAAATTGAAGCAAAGAAGCCGGAGGAGGAGTGAGTCC

GAGGCTCACATTCACACAG TTCTCCAAACCACTCCTGATCAGAAATACTGTCCAGATTCAGGAGGAGAGTCCAACAGAGGTCATGAAGAGACGTCAAGG

AACTGCCCCGCTGAAGCCGACACAGATGG GCACCCACAAGCCCAGAGTCCCCCAACAGGCTGTGATGTCACCTCAGGACATGCAGATACAGCAGCTGGG

TATACTGTTGCTGAG CTCTCAGTTGCTGGAACCGATGTGTCACCTTCTCTGGTGTACCACACTGCCTCAGCTCACCAAAGACTGAGCCCCTGTGAAGAC

TCTCTCAAACCTG - UNI30019 - GTTCCGAAGAAGGTCTCTCCCAGAAGCAGCGAGCACCTCGCAGACGGTGTCAGCAGCCCAAAATGTTGAGTAG

CCCCGAGGACACCATGTACTATAACCAGTTAAAT GGAACTCTAGAATATCAAGGGAGCCAGAGGAAGCCAAGAAAACTTGG ACAAATCAAAGTGCTGG

ATGGGGAGGACCAGTATTACAAATGCCTGTCCCCTGGGGCCTGTGCCCCTGAGGAAACCCACTCAGTCCACCCTTTCTTCTTCTCCTCGTCACCCAGAGA

AGACCCCTTTGCTCAACACTGAGTTGCCCTTTCCAGCCCCGGTGTGCCCCAGGTAAAAGCAGCCATGGTAACTGACCATCTAAGAGGAAGGCACTGTTCT

GAGGTCAGCTTCTTTGGACACAATCTGGGCCCTAAACCTTGCTGAACAACTCAACAGATTCCTGAAAATGCTGTCTCTTATTCCCCTTCACCTGCCCTGC

AGCCTGAGTCACAGAACCCGTGTTCCCTTCATCCCTTGAGAACACCTCTGCTGGGGTAATTCAGCCTTTTAGGCACCCGGCAGCTAAGAAGAGGGAGGAC

AGACCCACCACAGGCCAGTCGTGAAATCAGATAAGATGCCTAGTTTCCCCAAGTGGAATCCTGCTGGATTGCTATCTCCCTTCTACCCTTTTCTACCAGT

CCCCCATTTGCTAGGCTTTTCTACATCTCCCCTTGGGTCAGGGTTTCATTGCTGAGGATATTGTTTCCAGGAAGAGTGGCCATGGTTTATGCTTAGAAAG

AAAACTCAACATCTTTCAGATGCTCTCTCCATGTCAAAATGAATGCCTGTTGCACATTGTCATGTTGAGAAGACTTTGCCAGATTATTCTACCTTACCAA

GAGAACCCAGTCACACCAGCAATGAAAAGGAGGAGAATTGGGGCCTAAGTGATACCTGATTTTGTATCTGCATTCCCTGGCCAGCTGGCTCCACAGGATG

TGAGAGGCGGCAGAAGAGAGATCCCCACTTGTCCATCTCTGTGTTCCTCAGACCTAGCTCAGAGCCTAGGAGAGTGGGCACCCAGGGCATAAAAAGGAAT

GGAGAGATTGCATTATCTGCAGCAGCATGGCTGGCAGGCAGTTCCTTGCGGTGATATGTGATCTATGAGTAACCACCTTTCTCACAGATAAGTTCAAGGT

TGAGCTGTTCCTATTTCATGACATTATATGCCGTCATACTCTATACAGTTCAGTACAAGCAGCTTTCTTGAGCACATACCTGTGAGAACAAAACAAGATG

GAAGGTTGCTATGTGCTGTGACAGTGAGTCCGCGTGAAGACTCCTCTAGAGCAGATGTTCTTAATATTTTCTTTCTCTAAAATACTTTGTTGATTTCAGA

AAAATACTTTAAAATATAGAAAAAGTTACTATTGTCAGGGTTTGTTTTGTTTTGTTTTGTTTTCCTTTAACGGAGGGCACAAGCAAATATACTCTGAACA

GAAACAATTAAGTGAGGTTGGTGTGCTCACTTTTCCCATGGAGGTGTGGGACAACCTCTATACACACCAAGTAAGACACCCGTGACAGACAGAAGAAAGG

AAACCACCCAAGTCTAGCTTGCTGAAGCAGTGGGTTTAACCAGGCTTCCTGGGGCTGGAAGGATGGAGCAGAGGCTACGAGCACTTGCTCTTGCACAAGA

CCTGGGTTCAGTTCCCAGCACCCTCATGTGCACATACACATATACATGCAAGCAAGACATATATATATATATATATATATATATATATATATATATATAT

ATATTAAAATAAATAAATCTAAGATGGCTGTAGGGCTGCTTACAGAGGTATGGGCAGCTATACCACCAGAGAATAGCTATCCCCATAGTAACAGCTAACC

CCTCAGGGAAAGGCAGGGTCCCTCTGAATAAGTACACAGCTCTGCACACCTTTCCTGCTTCCACAAGAGAAATGTTAGTGAGCCCAGTCTTGCTCTGACT

TCAAGAGGACAGTGGCTACATCGTGTCCGGAGAACAGAGTTGCACAACAGAGACATTTAAAGAGCTCAGAAATTATAATATTATTTAAAAAAGTTATAGA

CAATTTTAGTAGATAAATTGTGCTTTTTTTTTAAAAAAAGATAAGTCTCGGGTTTTTCCAGCTCTTCGTTGAAAACGTAACATTTCTATGGTGTAAGAGT

GGAGCAGACAAAACAAAATTAACTTAGCTGCTTAGGAAATAATGCTTAGGGTAATTCTGTGATCCAGCACTTGAATGTGCAGGGTTTAATCCCCAGAACA

AGAAAGATGAAGAGATGAGAGGGAGAGAAAAAGCCTAGCATGTGCAGATTTTCTCTGAGTGCCTTCGGAAATTCCACTTTTATCATTGATTAATCTACTT

TGATGAAACTTTTTCAAACTGTTGATAAGAATATTCATAACTTTCTGCATGTCCACATACAATGTAATTGTAAATCTGCCTTGTTTCTTTCTCACTAAAA

TGTGTCTATGAATAAAGGTTAAAAGAAAAAGAAATAAAGAAAGAATCACTAAATCCTAA
Translation
 MMLGLESLPDPMETWEIIETIGKGTYGKVYKVANKRDGSLAAVKVLDPVS DMDEEIEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLE LC

NGGSVTELVKGLLRCGKRLDEAVISYILYGALL GLQHLHCHRIIHRDVKGNNILLTTEGGVKLVDFG GVSAQLTSTRLRRNTSVGTPFWMAPE VIAC

EQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPR RNPPPTLLHPDSWCEEFNHFISQ QCLIKDFEKRPSVTHLLDHPFIKGTQGKVL

CLQKQLAKVLQDQKHRNPVAKTR RHERMHTGRPHRVEDAGKCCLEDDLVNLEVLDE DTIIYWLQKRYADALIYTYVGDILIALNPFQNLSIYSPQ FS

RLYHGVKRSSNPPHIFASADNAYQCLVTFSKDQ CIVISGESGSGKTESAHLIVQHLTFLGK ADNQTLRQKILQVNSLVEAFGNARTAINDNSSRFGKY

LEMMFTPTGAVMGARISEYLLEKSRVIQQAA AGEKNFHIFYYIYAGLYHQKKLAEFRLPEEKPPR RYIAGETERVMQDITSKESYRTQFEAIQHCFKI

IGFADK EVHSVYRILAGILNIGSIEFAAISSQHQTDKSEVPNPEALENA AACVLCISSEELQEALTSHCVVTRGETIVRANTVDRAEDVRDAMSKALY

GRLFSWIVNRINTLLQPDKNIC CSAEDRMNVGILDIFGFEDFQRNSFEQLCINIANEQIQYYFNQHVFALEQ MEYKNEGVDAVLVQYEDNRPLLDMFL

QKPLGLLALLDEESRFPQGTDQTLVD DKFEDNLRCKFFWRPKGVELCFGIQHYAGP VLYDASGVLEKNRDTLPADVVVVLRTSENKLLQQLFSIPLTK

TG GNLAQTRAKITASSRSLPPHFSAGRAK VDTLEVIRHPEETTNMKRQTMASYFR YSLMDLLSKMVVGQPHFIRCIKPNDDRKALQFSQDRVLAQLR

STGILETVSIRRQGYSHRIFFEEFVKR RYYYLAFRAHQTPPANKESCVAILEKSRLDHWVLGKTK VFLKYYHVEQLNLLLREVMGRVVMLQAYTKGWL

GARRYKRAKEKREKGAITIQSA AWRGYDARRKLKQRSRRRSESEAHIHTV VLQTTPDQKYCPDSGGESNRGHEETSRNCPAEADTDG GHPQAQSPPT

GCDVTSGHADTAAGYTVAE LSVAGTDVSPSLVYHTASAHQRLSPCEDSLKPG - UNI30019 - GSEEGLSQKQRAPRRRCQQPKMLSSPEDTMYYN

QLN GTLEYQGSQRKPRKLG GQIKVLDGEDQYYKCLSPGACAPEETHSVHPFFFSSSPREDPFAQH
Transcript ENSMUST00000112241
Sequence
TGTCTGTGCCTTTCCTCACACACTAGTCTTAATCAAACATAAACTTTTCTAAACTCTGTTTAGGATATGGATGAGGAGATTGAGGCTGAATACAACATTC

TGCAGTTTCTCCCCAGCCATCCCAACGTTGTAAAGTTTTATGGGATGTTTTACAAAGCCGATCGCTGTGTGGGAGGACAGCTATGGCTGGTTCTGGAG C

TGTGTAATGGGGGCTCTGTCACTGAGCTTGTCAAGGGCCTTCTGAGGTGCGGCAAGAGGCTGGACGAAGCTGTGATTTCCTACATTCTGTATGGAGCCCT

CTTG GGCCTTCAGCATTTGCACTGCCACCGAATCATCCACCGAGATGTGAAGGGGAATAACATTCTTCTGACGACAGAAGGAGGAGTTAAGCTCGTTGA

CTTTG GTGTCTCTGCTCAACTTACAAGCACACGGCTGCGGAGAAACACATCAGTTGGGACCCCATTCTGGATGGCTCCTGAG GTCATTGCTTGCGAGC

AGCAGTATGACTCGTCCTATGACGCTCGTTGTGACGTCTGGTCCTTGGGCATCACAGCCATTGAGCTGGGAGATGGAGACCCTCCCCTCTTTGAAATGCA

TCCTGTGAAAATGCTCTTTAAGATACCAAG CATTTAGGAGATGGAGGAGGGAAGATCAGAAGCCCAAGGTCAGCCTTGGCTACACAAGGACCTGAGGCC

AGCCTGGCGCACAGGAGAACTTGTAAAGCTAATAAGGTCTATTAGAATCAGCGTGGCACAGAGGCACATGCCTGAAGTCCCAGCACTTAGATGATCAAGC

TCCAGGCCAACAAGGCAACAGAGGAAGACTCAAACCCCATCATCTCCCCTGCGAAAGAGAGAAAAGTGAAAGAACAGACAAGCTTGAAACTTCAGAAATA

CCCACCCTTATCGCCTTCCTCAGTTTGAACTATTATTGTGGAAGAAATTGTCATTGATATTAACCATAAAACTTGTACTTAGGCAGTGGTGGTCTACAAG

CGACATGGCTCTGGTGCCTTTTGTCCCCACTTCCTTCCAGAAGCCCTCCCACCTGGTGTGCTTGCAAACAGCTTCTGTCTTCCTCCCCTGTTTTCCCTGA

GGAATAGAAGTGATAATGGAGTCTTTCTAATGGCTACAGGTATTTAGCACAGGCATCTTTCCCACCCTGGAGCAATTGTTCATTCTTGATGGTGGTGTAG

TTTACCATGAGATTGAGTTTTTTGTATCATCTTGTCTTGAGTTTAAAGAAATGTCTTCAACGATTGCTTTGAAATTTTGGACTTATTCTCCTTTGGCATA

ATTATAGCATATGTAAGTTTTAAA
Translation
MDEEIEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLE LCNGGSVTELVKGLLRCGKRLDEAVISYILYGALL GLQHLHCHRIIHRDVKGNN

ILLTTEGGVKLVDFG GVSAQLTSTRLRRNTSVGTPFWMAPE VIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPS SI
Transcript ENSMUST00000112240
Sequence
ATCTCTGGGCCGCTTGAACAATGGCAG CAGCCTCGGAGGTGAGCGGTGAGCACACAGGAGACAAAACCGG GAAGCACCTGTATGGATTATTTCACTAT

AACCCCATGATGCTTGGCCTGGAATCACTCCCCGATCCCATGGAGACCTGGGAGATTATAGAGACGATTGGCAAAGGCACTTATGGCAAGGTCTACAAGG

TAGCCAACAAGAGAGATGGGAGCCTGGCTGCCGTGAAGGTTCTGGACCCCGTCAGT GATATGGATGAGGAGATTGAGGCTGAATACAACATTCTGCAGT

TTCTCCCCAGCCATCCCAACGTTGTAAAGTTTTATGGGATGTTTTACAAAGCCGATCGCTGTGTGGGAGGACAGCTATGGCTGGTTCTGGAG CTGTGTA

ATGGGGGCTCTGTCACTGAGCTTGTCAAGGGCCTTCTGAGGTGCGGCAAGAGGCTGGACGAAGCTGTGATTTCCTACATTCTGTATGGAGCCCTCTTG G

GCCTTCAGCATTTGCACTGCCACCGAATCATCCACCGAGATGTGAAGGGGAATAACATTCTTCTGACGACAGAAGGAGGAGTTAAGCTCGTTGACTTTG 

GTGTCTCTGCTCAACTTACAAGCACACGGCTGCGGAGAAACACATCAGTTGGGACCCCATTCTGGATGGCTCCTGAG GTCATTGCTTGCGAGCAGCAGT

ATGACTCGTCCTATGACGCTCGTTGTGACGTCTGGTCCTTGGGCATCACAGCCATTGAGCTGGGAGATGGAGACCCTCCCCTCTTTGAAATGCATCCTGT

GAAAATGCTCTTTAAGATACCAAG CATT
Translation
   MDEEIEAEYNILQFLPSHPNVVKFYGMFYKADRCVGGQLWLVLE LCNGGSVTELVKGLLRCGKRLDEAVISYILYGALL GLQHLHCHRIIHRDVK

GNNILLTTEGGVKLVDFG GVSAQLTSTRLRRNTSVGTPFWMAPE VIACEQQYDSSYDARCDVWSLGITAIELGDGDPPLFEMHPVKMLFKIPS SI

For any suggestions or comments, please send an email to unitrap@crg.es