Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042073 (Abhd14b)
Chromosomal location
Chr 9: 106350992 - 106355246 (+)
Description
abhydrolase domain containing 14b Gene [Source:MGI Symbol;Acc:MGI:1923741]
RefSeq_dna
NM_029631 
RefSeq_peptide
NP_083907.3 
UniGene
Mm.335427 
MGI
MGI:1923741 
Uniprot/SWISSPROT
Q8VCR7 
Human Ortholog
ENSG00000114779 (ABHD14B)
Omim not available
UniTrap UNI35291
Vector Insertion
Chr 9: 106351041 - 106352334
Public Clones IST14481C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22683
Vector Insertion
Chr 9: 106353723 - 106353740
Public Clones not available
Private Clones OST287978 (lexicon) OST286723 (lexicon) OST278313 (lexicon) OST236518 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21795
Vector Insertion
Chr 9: 106353966 - 106354314
Public Clones IST13668G11 (tigm) IST13399B8 (tigm)
Private Clones OST317797 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112485
Sequence
CGTCAATAGCACACGCCATTCTCCTGCGGAAGACCACGCACATTTCCAG - UNI35291 - GCACATCACCACTGGGCATGGCCGGTGTGGACCAGCA

TGAGGGCACCATCAAGGTGCAGGGCCAGAACCTCTTCTTCAGAGAGACCCGGCCTGGGAGTGGGCAGCCTGTCCGCTTCTCTGTGCTGCTGCTGCATGGT

ATCCGCTTCTCCTCGGAGACTTGGCAGAACCTGGGTACTCTGCAGAGGCTGGCCGAGGCTGGCTACAGGGCTGTGGCCATTGATCTGCCAG ATGCCTTT

GGGCTCACTTCCCTTCCCTCATCTGTAATG TCTACTA - UNI22683 - GTCTTGGGCGATCCAA - UNI22683 - CTTCCTAGCTGCTGTGGT

GGATACCTTGGAGCTGGGACCCCCAGTTGTGATCAGTCCATCATTAAGTGGCATGTATTCACTGCCCTTCCTCGTGGCCCCCGGGTCCCAACTCCGGGGC

TTTGTACCAGTGGCTCCTATCTGCACAGACAAAATCAATGCTGTGGACTACGCCAGTGTGAAG - UNI21795 - ACTCCAGCTCTCATTGTATATGG

AGACCAGGACCCCATGGGCTCCTCCAGCTTTCAACACCTGAAGCAGCTGCCCAACCACAGAGTGCTGGTCATGGAAGGGGCAGGGCATCCCTGTTACTTG

GACAAGCCTGATGAGTGGCATAAGGGGCTGCTGGATTTCCTGCAAGGGCTAGCCTGAGACTCAGTCCTGATGATAGGAGGTTACAGACTGCCTGCTCTAG

GATCTCTTGCTGTCTTCTCCTGGTCTCTGGCTTCTGCCTCACCTGCAACAGGTCTGTCTATACATCTGTCTGGGTTGCTGTCATTTCTGTTTTTCTCTTG

CAGTGACAGATCAGATCAAGGCGGTAAATCAAGTGGAAAAAGCGTCGGGTTCAAGGGGAGAACTCTGATTGTGGGTAATCCATAAGCTTCCTCTACAGGC

TCCCCGCTTGGTTCTCACTTCTGCCTTACTTCACTTTCTGATCCATCTCTCTCTTCAGCCGCTCCACAGGACAGCCATTCCTTCTGCCGCCCACCCCCCT

TAGACCACAGACAGCATATGGGTATTGCTTGTTTAGATCCATCCCACACCCAGACAGAACCTTTCCCTTGGGAGCAGCACAGGGGTCCCACATTCTTGTG

TAGTTTGCACAGGTACATGTGCAGTTTCCTGAAGGATGGAGGGAATCTTTGTAAACAGAGATCCACTTGCCAGGATAAAAATGTGGCCACCGCTAGATTT

CTCTTACCTACCCGTTGCAACTGGTCCCAGACCAGAATGGCCTCCTCAGAAGGGGAGGTGCTCTTCAAATCTCCCTTAGGGGCTGCATACCTCCCCAGGT

AATCAAGCACGGATCTTCTCAGCCAAGCCCATTTCCTGCCCTGAGGTTTGGGAGTGGGATAAGGAGAGGAGACCGACTTCGGAGGTCCCTGAAATAAAGT

GATACAATT
Translation
 - UNI35291 - MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLPD DAFGLTSLPSSVM 

STS - UNI22683 - SLGRSN - UNI22683 - NFLAAVVDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVK -

 UNI21795 - TPALIVYGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA
Transcript ENSMUST00000048527
Sequence
CGTCAATAGCACACGCCATTCTCCTGCGGAAGACCACGCACATTTCCAG - UNI35291 - GCACATCACCACTGGGCATGGCCGGTGTGGACCAGCA

TGAGGGCACCATCAAGGTGCAGGGCCAGAACCTCTTCTTCAGAGAGACCCGGCCTGGGAGTGGGCAGCCTGTCCGCTTCTCTGTGCTGCTGCTGCATGGT

ATCCGCTTCTCCTCGGAGACTTGGCAGAACCTGGGTACTCTGCAGAGGCTGGCCGAGGCTGGCTACAGGGCTGTGGCCATTGATCTGCCAG - UNI226

83 - GTCTTGGGCGATCCAAGGAAGCAGCAGCCCCTGCCCCTATTGGGGAACCGGCCCCTGGCAGCTTCCTAGCTGCTGTGGTGGATACCTTGGAGCTG

GGACCCCCAGTTGTGATCAGTCCATCATTAAGTGGCATGTATTCACTGCCCTTCCTCGTGGCCCCCGGGTCCCAACTCCGGGGCTTTGTACCAGTGGCTC

CTATCTGCACAGACAAAATCAATGCTGTGGACTACGCCAGTGTGAAG - UNI21795 - ACTCCAGCTCTCATTGTATATGGAGACCAGGACCCCATG

GGCTCCTCCAGCTTTCAACACCTGAAGCAGCTGCCCAACCACAGAGTGCTGGTCATGGAAGGGGCAGGGCATCCCTGTTACTTGGACAAGCCTGATGAGT

GGCATAAGGGGCTGCTGGATTTCCTGCAAGGGCTAGCCTGAGACTCAGTCCTGATGATAGGAGGTTACAGACTGCCTGCTCTAGGATCTCTTGCTGTCTT

CTCCTGGTCTCTGGCTTCTGCCTCACCTGCAACAGGTCTGTCTATACATCTGTCTGGGTTGCTGTCATTTCTGTTTTTCTCTTGCAGTGACAGATCAGAT

CAAGGCGGTAAATCAAGTGGAAAAAGCGTCGGGTTCAAGGGGAGAACTCTGATTGTGGGTAATCCATAAGCTTCCTCTACAGGCTCCCCGCTTGGTTCTC

ACTTCTGCCTTACTTCACTTTCTGATCCATCTCTCTCTTCAGCCGCTCCACAGGACAGCCATTCCTTCTGCCGCCCACCCCCCTTAGACCACAGACAGCA

TATGGGTATTGCTTGTTTAGATCCATCCCACACCCAGACAGAACCTTTCCCTTGGGAGCAGCACAGGGGTCCCACATTCTTGTGTAGTTTGCACAGGTAC

ATGTGCAGTTTCCTGAAGGATGGAGGGAATCTTTGTAAACAGAGATCCACTTGCCAGGATAAAAATGTGGCCACCGCTAGATTTCTCTTACCTACCCGTT

GCAACTGGTCCCAGACCAGAATGGCCTCCTCAGAAGGGGAGGTGCTCTTCAAATCTCCCTTAGGGGCTGCATACCTCCCCAGGTAATCAAGCACGGATCT

TCTCAGCCAAGCCCATTTCCTGCCCTGAGGTTTGGGAGTGGGATAAGGAGAGGAGACCGACTTCGGAGGTCCCTGAAATAAAGTGATACAATT
Translation
 - UNI35291 - MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLPG - UNI22683 - G

LGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTDKINAVDYASVK - UNI21795 - TPALIV

YGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA

For any suggestions or comments, please send an email to unitrap@crg.es