Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042106 (6230427J02Rik)
Chromosomal location
Chr 9: 107886557 - 107888210 (-)
Description
RIKEN cDNA 6230427J02 gene Gene [Source:MGI Symbol;Acc:MGI:1915426]
RefSeq_peptide
NP_080873.1 
UniGene
Mm.76166 
MGI
MGI:1915426 
Uniprot/SWISSPROT
Q9CX62 
Uniprot/SPTREMBL
Q08EG3 
Human Ortholog
ENSG00000185614 (C3orf54)
Omim not available
UniTrap UNI23660
Vector Insertion
Chr 9: 107887396 - 107888027
Public Clones CMHD-GT_433C6-3 (cmhd)
Private Clones OST250182 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048568
Sequence
AAGGAGCCTTAGAGTAAGGCAAGGGTGAGGACGCCACCACCCGCGGGCCGACCCGGCCCACTCTGCGCCGCTCCCGCGGGTGATCGGCGGGTGAGCCGGC

CGACCTGGAGAGTGTACAGCACCAGCACCAGCATGCACAGCGCTCGGCTTGACAGCTTCCTGAGCCAGCTCCGCTGGGAACTG - UNI23660 - TTG

TGTGCTCGGGACACAGGCTCACCTCCAATGTCTGGCCCACTGCAACCAAAACCCAGAACTGATCAAAATGTACAGCCAAAGCGCCAGTTCAGGGCCTCGG

ATGTTTTGGAAGAGGACTCTGTCTGCTGTGTAGAAGAGGAAGAGGAGGAAGGCTTGGTAGCAGAAGACAAGGGTTTACCCTTGGGATGTCCTAGGGAGCA

TGCTCTAGACTGGGACTCTGGCTTCTCCGAGGTGTCAGGCAGTACATGGCGAGAGGAAGAGCCGTCTGTACCCCAGCGCCAAGCACCTCGAGAACGTCCA

CCTCATAGCCAGCGTTTCTCAGTCAGTGACATTCCTATGCGCAGTAGGGCAGCTGTAACCAACATACCTCCTGCCCACCGTCCGAGGCCCAAGTCCACCC

CAGATGCTTGCCTGGAACATTGGCAGGGATTGGAAGCAGAGGACTGGACGGCAGCCCTGCTGAACAGGGGCCGCAGTCGGCAGCCCCTGGTGCTAGGGGA

TAACTGTTTTGCTGATTTAGTTCACAATTGGATGGAGTTGCCTGAAGCAACCAGTGAGGGGAGTGATGGAGATGTACCCCGAGCACGGGCTCGACCCCCT

CAGTTCCTGCTTGGTCTCTCTGAGCAGCTACGGCGTAGGCTGGCCAGGGCTCGACGGACAGCTATGGCAAGCAAGAGGTTGTCCTGCCCACCTCGCTCAG

AACCTGACCTGCCTGCAGACATCTCACGATTTGCAGCCCTCATGAACTGTCGAAGTCGCCAACCTATTATCTACAATGATGTCAGCTACCTCTGACCCTG

CCCCTCCAGCTAGGGACAATAAAGGCTTTTTTTCCT
Translation
MHSARLDSFLSQLRWEL - UNI23660 - LCARDTGSPPMSGPLQPKPRTDQNVQPKRQFRASDVLEEDSVCCVEEEEEEGLVAEDKGLPLGCPREHA

LDWDSGFSEVSGSTWREEEPSVPQRQAPRERPPHSQRFSVSDIPMRSRAAVTNIPPAHRPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDN

CFADLVHNWMELPEATSEGSDGDVPRARARPPQFLLGLSEQLRRRLARARRTAMASKRLSCPPRSEPDLPADISRFAALMNCRSRQPIIYNDVSYL

For any suggestions or comments, please send an email to unitrap@crg.es