Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042138 (BC024479)
Chromosomal location
Chr 9: 37296906 - 37331733 (+)
Description
Uncharacterized protein C11orf61 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q6NZR2]
RefSeq_dna
NM_146222 
RefSeq_peptide
NP_666334.2 
UniGene
Mm.127892 
MGI
MGI:2384579 
Uniprot/SWISSPROT
Q6NZR2 
Human Ortholog
ENSG00000120458 (C11orf61)
Omim not available
UniTrap UNI15908
Vector Insertion
Chr 9: 37297419 - 37324801
Public Clones IST11528H11 (tigm)
Private Clones OST470442 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048604
Sequence
AAGATGGCTGCGCCCTGTGGCTCGGAGCTGCCCGCCAACTCGCCGCTCAAAATTCCGAAGATGGAGGTGCTTTCCCCGGCGTCTCCCGGCGACCTGAGCG

ACGGGAACCCATCGCTGTCCGACCCTTCCACGCCTCGGGGAGCCTCCCCTCTCGGGCCCGGCAGCGCGGCGGGCTCGGGGGCCGCGGCGTCCGGGGGTCT

CGGGCTGGGGCTGGGGGGCCGCGGCGCTGCCTCGTCCTCGGTCTCCTTCTCGCCCGGCGGCGGCAGTGGCGGGGCTGCGGCGGCCGCTGCCGCCGCCTGC

CGGGGTATGTCGTGGACGCCGGCAGAGACGAACGCGCTCATCGCTGTATGGGGCAACGAGCGGCTGGTGGAGGCGCGGTACCAGCAGCTGGAGGGAGCCG

GCACGGTATTCGGCAGCAAGGCCCCTGGGCCGGCCATGTACGAGCGCGTGTCCCGGGCCCTGGCCGAGCTGGGCTACGAGCGGACCCCGTCCCAGTGCCG

GGAGCGCATCAAG - UNI15908 - ACCCTTCGCAGGTGTTACAGTCGGGTGAAAGAACATGGTGTTGGGAAAAGAAAGAGCAGTTACACATTTGAAC

AGTTGGAACAGGTGTTTGGTCAGGGAGGATGGGATGCTCAGCCCTGCCAGCCTGTACTTATTAACAGTAGTGGCTTGTACCAGGAGCTGGAGTCAGATGG

CAGCACTATGGAGGACTATTCACAGGAGGACTGGGGAAACCACAGTCAGGAGCTCCATGGCTATCCAACAGATCAGGAATTGG ATGAAATGCCAGTTTC

AAAGAGAACGTTAAAAATAAAACAAGAGTCTTCTGAAGAGGCACA GAAGCGAGATACCATGCAGAATATTGTACAGATTTTGGAGTCGGTGCAGTTGAA

ATGGGAACTGTTTCAGAGTTGGACAGACTTCTCAAGGCTCCATCTTTCCAATAAATTGGCCATTTTTGGAATTGGCTATAACACCCGCTGGAAAGAGGAT

ATTCGTTACCATTATGCTGAGATCAGCTCACAGGTGCCCCTTGGCAAGCGTCTTCGCGAGTATTTCAACTCTGAGAAGCCTGAGGGACGGATCATTATGA

CCCGGGTGCAAAAAATGAACTGGAAAAATGTTTACTACAAGTTTTTAGAGATCACCATCAGTGAAGCGAGGTGCCTAGAGCTGCACATGGAGATTGACTG

GATACCCATTGCCCACTCGAAGCCAACCGGGGGCAATGTTGTTCAGTATTTATTGCCAGGAGGCATTCCTAAAAGCCCAGGCCTTTATGCCATTGGCTAT

GAAGAATGTATCGAGAGGCCTCTCTCACCAGATGTGGAGCGCCATGCTCTGGACCCAGGGAAAGAGGGCCGAGTCGACCTGGAGACCCTCTCAGCACAAG

CCTCATTACAGGTGGAAGTGGAACCCACCCGGATCATCTACTGCTACCTCGGTATTGCTGAGGTCAGGACTCTGCAGCAGTGCTTGTTTTTACATTTCCA

AGCAAATGCCAAAACCTTCAGTAAAGAGTGGGTTGGTATTAATGGGTTTTTGTCTCAGAACTGTATTGTGGATCCTGGAGTTTCCCCCAAGTCCATCTAC

ATCAAATTTGTAGAAGTAGAGAGGGATTTTCTTTCTGCCGGCTCATTAGTTGAGTGTCTGGAAAAAGCCATTGGATACCCCTTAAAATTTAACAACTGAG

TGTCATCCTTCATAAGGATTTGGGCTTGTGCAGTCTTGTCCCTTCTTCCCATTACCCAGACTACCCCACGTCCAGATGCTGCCGTCGGACTCTTCATGGG

AGCTTTTTCCACGATGAGACCAATACAACCTCTAAGAAATCATAGACTCTGGGCAGGAAAAGCAGACCTCACCTGAAATGCTCATTTTGAGCAAGCAGGT

CTTGCATGGTGGGTCAGTTCTTTTTTACAAAAAGAAAACATCGATTTTAAAACTGGTTTTAGAGCCTTGATATAAGCAAATGTAGGTACATTCCATATTG

GACAAAACTTATACTTTGAGTTTCATATGAAATTGAAAATTGTATTTTTTTCACTGTTTCATTTTTACACATCTCTATAAGTATTATTTACAACCTTGAA

TAAATAAGCAATAGATAATGGCGAGTAAATCAAGTCACAGTAAATACAGCTGTTTTTAAATATTACCTTTAGCTACTATTGTATATAATTTAGAATTCAT

TTTTTCACCGACCAAGTGTTTTACTATTTCCAATCAGTGTTGCCTGCAAAGACTTTTGTTTATGTGATGTACCAACTTTTATGGTTGTGTTGCCATTTAA

ACTTT
Translation
MAAPCGSELPANSPLKIPKMEVLSPASPGDLSDGNPSLSDPSTPRGASPLGPGSAAGSGAAASGGLGLGLGGRGAASSSVSFSPGGGSGGAAAAAAAACR

GMSWTPAETNALIAVWGNERLVEARYQQLEGAGTVFGSKAPGPAMYERVSRALAELGYERTPSQCRERIK - UNI15908 - TLRRCYSRVKEHGVGK

RKSSYTFEQLEQVFGQGGWDAQPCQPVLINSSGLYQELESDGSTMEDYSQEDWGNHSQELHGYPTDQELD DEMPVSKRTLKIKQESSEEAQ QKRDTMQ

NIVQILESVQLKWELFQSWTDFSRLHLSNKLAIFGIGYNTRWKEDIRYHYAEISSQVPLGKRLREYFNSEKPEGRIIMTRVQKMNWKNVYYKFLEITISE

ARCLELHMEIDWIPIAHSKPTGGNVVQYLLPGGIPKSPGLYAIGYEECIERPLSPDVERHALDPGKEGRVDLETLSAQASLQVEVEPTRIIYCYLGIAEV

RTLQQCLFLHFQANAKTFSKEWVGINGFLSQNCIVDPGVSPKSIYIKFVEVERDFLSAGSLVECLEKAIGYPLKFNN

For any suggestions or comments, please send an email to unitrap@crg.es