Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042156 (Dzip1)
Chromosomal location
Chr 14: 119275483 - 119324609 (-)
Description
DAZ interacting protein 1 Gene [Source:MGI Symbol;Acc:MGI:1914311]
RefSeq_peptide
NP_080219.2 
MGI
MGI:1914311 
Uniprot/SWISSPROT
Q8BMD2 
Uniprot/SPTREMBL
Q3URS5 Q4QQM0 Q6PAU2 Q80W18 
Human Ortholog
ENSG00000134874 (DZIP1)
Omim not available
UniTrap UNI26394
Vector Insertion
Chr 14: 119323741 - 119324362
Public Clones not available
Private Clones OST121219 (lexicon) OST107003 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110728
Sequence
CACCCACGGCCTGGAGCCTGGGAGGACAAGGAGCGACGCTGGGCTACCCGCCTCGTCACAACTTGCCCGGACCAGACACGCTTTATCTTGCGCCCTGGAA

GAAGGAGCCGCCTGCCTCTTGCTGCTCAGTTGCTCCTCGGCCTCGGCGAGCCCCGCCTCTGCGCCAGCAGCAATCCCGGGATCTGGATCCCCCGTGACTC

CCCGTGCCTTGCAGCGCCCGGCTTTCGCCCAGGAGCGCGCAGCTGGG - UNI26394 - GTGCTTGAAACACAGCGGTGAGCGACACACCTCCCCTGT

TCCCGCTGATCCTGCCAGCCCAGTGGATGGAGCCCAGAATCCACAAACCTGCCAG GTCCCTGGGCGCATGCTGAACGCGCGTGGGCGGACACGCCCTGT

ACTCCAGGTCGGGGCAGGGCGCTGCCATAGCAACGTCCTGGACGCCCAGATCCTAGGCCGCCGCCGCCGCCGCCGCAGCCGCAGCCGGGGTCTGGGCCAT

CAGAGGCTCACGAGGAGAGTGGCGGCGGCGGCCCAAGGCGGCCAGGGCTGGGGAGACGACTCTGCTCCGCCCCTCCAGCGCAAGCCTAGGCGGCGGACTG

GCTTGCAAGCATG CCCTTCCAGAAGCACGTCTACTACCCTCTGGCCAACAGCCCCGAGGGGCCTGACGCCTCTGCCATAGGCGCGGCTCCCATGGCCTT

TGTCCCCCCCAGCGCGGCCTCGGGCCCCCTGCCCTTCTTCCAGTTCCGGCCGCGACTGGAGAGCGTGGACTGGAGGCGGCTGAGCGCCATCGACGTGGAC

AAGGTTGCCGGCGCCGTGGACGTCCTGACACTGCAGGAGAACATTATGAACATCACCTTCTGCAAGCTGGAGGACGAGAAGTGCCCGCACTGCCAGTCAG

GGGTAGACCCAGTGCTGCTGAAGCTGATCCGCCTGGCGCAGCTCACGATCGAATACCTGATGCACTCGCAGGAGTTCCTCACCTCGCAGCTAAACCTGGT

GGAGGAGAGGCTGCGCCTGAGCCTGCTCGACTATGAGCAGAGCAAGCAGCTGCTCACCAAGCAGGCTGGCGAGATCAAGCTGCTGAAGGAGGAGTGTAAA

CGCAGGAAGAAGATGCTGTCCACGCAGCAGCTGATGATAGAGGCCAAGGCCAGCTATTACCAG TGCCATTTCTGTGACAAGGCCTTTATGAACCAAGCG

TTCCTACAAAGCCACATCCAGCGCCGCCATACTGAAGACTCTCACCTCG AGTATAATACAAAGGCCCAGACCGACAGGCTCCAGAAGGAGATTGACATG

TTGAAGGAACAGCTGCAGCTCACTAGGTCTCAGCTGGAGTCTGCACAGCACTCTCATGCAGTTCGCTTCTCTAAG GACTATGAAATGCAGAAATCAAAA

GAGGAAGACTTTCTGAAGCTGTTTGACAGATGGAAAGAGGAGGAGAAGGAGAAGTTACTCGAGGAGATGGAGAAGGTCAAGGGGATGTTTATGAGGGAAT

TTAAAGAGTTAACTTCTAAGAACTCAGCATTAGAATAT TTGTTAGAAATACAGAAGTCTAACATCCAGATCAAGTCCAACATAGGCACCTTAAGAGACG

TTACTGAGCTGAGAGAAGACCATCTTCCGTGTCCCCAGGACTTCCAGAACATGCTACAGCTGCTTGACAGCCAG GCAAGCAAGTGGACAGATCGATTTC

AAGTTCTCAACGAAGAACACAGCAAGGAAAAGGGGCAG CTCCTGTCCCACATAGAGAAGCTTCGAAGCTCAATGATGAAGGATTTAAGTGCAGATAATG

TCTTCTACAAGAGGCGGGTAGAAGAGTTAGGCCAGAAACTGCAGGAGCAGAACGAGCTGATTATCAGTCAGAAGCAGCAG ATTAGAGAATTTGCCAGTA

AACCATACAGCAGCATCAGCGAGCTGAAAG GGACTCCTTTAACCCGACAAACACTGGAACCTAAATCGGCTGCACCAACCACACCCA TGACTGCCTCG

GCCACACAGAATCTGGATGGTGCATCCAGCCTGACCATGGTACATG AGCAAGTGTTCTCTTCACACATACTGGAACCAATAGAAGAACTTTCTTCAGAG

GAGGAAAAAG GTCGAGAAAATGAGCAGAAATTAAATAAAAAGACGTCCTTAAGGAAACCGTCGAGCACCAGCCCATCCCCCCAGGAGCTGAGGACTAAC

CTGGAGCGGGAGCTGGGGAATAAACTAAGAAGCTTTGGGATTGGCGCG AACATCCAAGGTATTCCGTGCGAGATCTTGAATAGATCGCTTAAAGCCATG

CAAGTTGCCAGACATGACCTAGCAAAACAAATGCCTGACATCCAGCAAATCCGAGAATCCCTCGAGCACCAGCTGATCTGTAAGATGGAGGAAAAAGTGT

CACTCTCTTCAG ACAGGCACCATGTCCCTTCCATGACCACCTTTCCACCCGAAGAAGTACCCAAGGCAACCCAGCTTCCCCACAAAAGCAGACCGTTGG

TCAGACAGAGAACTGTGTTTACTGATAAAGTGTCTGTCCCAAA ACTTAAGAAAAATACCAAAGAAAGTCATTTTCTCAGAAGGTTTCCATCCACCAA G

ACGCCTCCCTTCAGCTCGGAAGAGGAGCCAGATGAAGAGGACCTCCTCCATGCTTACCTCTCCCCAGACTCACTTGCCACCGCTGCCACACAGCCACCTA

AAAGCAGCATGAGTCACTTTGGAAAGAGCGCTGTCAAAAGTGACACGGACTGGACGGAGGGAAGTGAAATGGATGACTCGGACTTCTCTCCTAAGCTGAC

AG GAACCTCCATTACGATACAGACTGACACTGTTGAGACCATGGCTTTACCCCAAGGAAGTGGGAATAAAGCAGTGCCGGGAATGAACCCTGCTGACAC

GGTTATCAAAAAGGAATCGTTGCAAGAGTTAAAG TTCGGTTCTGTAGGTAGACAATTGTGGAGTCTGTCTGTGCTGTCTGACAGCAGGTGTGGACTGAA

CAATGTGAGATCTGAAATTTGA
Translation
 - UNI26394 -  M PFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFC

KLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQ

 CHFCDKAFMNQAFLQSHIQRRHTEDSHLE EYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSK DYEMQKSKEEDFLKLFDRWKEEEKEK

LLEEMEKVKGMFMREFKELTSKNSALEY LLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQ ASKWTDRFQVLNEEHSKEKGQ LLS

HIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQ IREFASKPYSSISELKG GTPLTRQTLEPKSAAPTTPM MTASATQNLDGASSLT

MVHE EQVFSSHILEPIEELSSEEEKG GRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGA NIQGIPCEILNRSLKAMQVARHDLA

KQMPDIQQIRESLEHQLICKMEEKVSLSSD DRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPK KLKKNTKESHFLRRFPSTK KTPP

FSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTG GTSITIQTDTVETMALPQGSGNKAVPGMNPADTV

IKKESLQELK FGSVGRQLWSLSVLSDSRCGLNNVRSEI
Transcript ENSMUST00000004055
Sequence
CACCCACGGCCTGGAGCCTGGGAGGACAAGGAGCGACGCTGGGCTACCCGCCTCGTCACAACTTGCCCGGACCAGACACGCTTTATCTTGCGCCCTGGAA

GAAGGAGCCGCCTGCCTCTTGCTGCTCAGTTGCTCCTCGGCCTCGGCGAGCCCCGCCTCTGCGCCAGCAGCAATCCCGGGATCTGGATCCCCCGTGACTC

CCCGTGCCTTGCAGCGCCCGGCTTTCGCCCAGGAGCGCGCAGCTGGG - UNI26394 - GTGCTTGAAACACAGCGGTGAGCGACACACCTCCCCTGT

TCCCGCTGATCCTGCCAGCCCAGTGGATGGAGCCCAGAATCCACAAACCTGCCAG GTCCCTGGGCGCATGCTGAACGCGCGTGGGCGGACACGCCCTGT

ACTCCAGGTCGGGGCAGGGCGCTGCCATAGCAACGTCCTGGACGCCCAGATCCTAGGCCGCCGCCGCCGCCGCCGCAGCCGCAGCCGGGGTCTGGGCCAT

CAGAGGCTCACGAGGAGAGTGGCGGCGGCGGCCCAAGGCGGCCAGGGCTGGGGAGACGACTCTGCTCCGCCCCTCCAGCGCAAGCCTAGGCGGCGGACTG

GCTTGCAAGCATG CCCTTCCAGAAGCACGTCTACTACCCTCTGGCCAACAGCCCCGAGGGGCCTGACGCCTCTGCCATAGGCGCGGCTCCCATGGCCTT

TGTCCCCCCCAGCGCGGCCTCGGGCCCCCTGCCCTTCTTCCAGTTCCGGCCGCGACTGGAGAGCGTGGACTGGAGGCGGCTGAGCGCCATCGACGTGGAC

AAGGTTGCCGGCGCCGTGGACGTCCTGACACTGCAGGAGAACATTATGAACATCACCTTCTGCAAGCTGGAGGACGAGAAGTGCCCGCACTGCCAGTCAG

GGGTAGACCCAGTGCTGCTGAAGCTGATCCGCCTGGCGCAGCTCACGATCGAATACCTGATGCACTCGCAGGAGTTCCTCACCTCGCAGCTAAACCTGGT

GGAGGAGAGGCTGCGCCTGAGCCTGCTCGACTATGAGCAGAGCAAGCAGCTGCTCACCAAGCAGGCTGGCGAGATCAAGCTGCTGAAGGAGGAGTGTAAA

CGCAGGAAGAAGATGCTGTCCACGCAGCAGCTGATGATAGAGGCCAAGGCCAGCTATTACCAG TGCCATTTCTGTGACAAGGCCTTTATGAACCAAGCG

TTCCTACAAAGCCACATCCAGCGCCGCCATACTGAAGACTCTCACCTCG AGTATAATACAAAGGCCCAGACCGACAGGCTCCAGAAGGAGATTGACATG

TTGAAGGAACAGCTGCAGCTCACTAGGTCTCAGCTGGAGTCTGCACAGCACTCTCATGCAGTTCGCTTCTCTAAG GACTATGAAATGCAGAAATCAAAA

GAGGAAGACTTTCTGAAGCTGTTTGACAGATGGAAAGAGGAGGAGAAGGAGAAGTTACTCGAGGAGATGGAGAAGGTCAAGGGGATGTTTATGAGGGAAT

TTAAAGAGTTAACTTCTAAGAACTCAGCATTAGAATAT CAGTTGTTAGAAATACAGAAGTCTAACATCCAGATCAAGTCCAACATAGGCACCTTAAGAG

ACGTTACTGAGCTGAGAGAAGACCATCTTCCGTGTCCCCAGGACTTCCAGAACATGCTACAGCTGCTTGACAGCCAG GCAAGCAAGTGGACAGATCGAT

TTCAAGTTCTCAACGAAGAACACAGCAAGGAAAAGGGGCAG CTCCTGTCCCACATAGAGAAGCTTCGAAGCTCAATGATGAAGGATTTAAGTGCAGATA

ATGTCTTCTACAAGAGGCGGGTAGAAGAGTTAGGCCAGAAACTGCAGGAGCAGAACGAGCTGATTATCAGTCAGAAGCAGCAG ATTAGAGAATTTGCCA

GTAAACCATACAGCAGCATCAGCGAGCTGAAAG GGACTCCTTTAACCCGACAAACACTGGAACCTAAATCGGCTGCACCAACCACACCCA TGACTGCC

TCGGCCACACAGAATCTGGATGGTGCATCCAGCCTGACCATGGTACATG AGCAAGTGTTCTCTTCACACATACTGGAACCAATAGAAGAACTTTCTTCA

GAGGAGGAAAAAG GTCGAGAAAATGAGCAGAAATTAAATAAAAAGACGTCCTTAAGGAAACCGTCGAGCACCAGCCCATCCCCCCAGGAGCTGAGGACT

AACCTGGAGCGGGAGCTGGGGAATAAACTAAGAAGCTTTGGGATTGGCGCG AACATCCAAGGTATTCCGTGCGAGATCTTGAATAGATCGCTTAAAGCC

ATGCAAGTTGCCAGACATGACCTAGCAAAACAAATGCCTGACATCCAGCAAATCCGAGAATCCCTCGAGCACCAGCTGATCTGTAAGATGGAGGAAAAAG

TGTCACTCTCTTCAG ACAGGCACCATGTCCCTTCCATGACCACCTTTCCACCCGAAGAAGTACCCAAGGCAACCCAGCTTCCCCACAAAAGCAGACCGT

TGGTCAGACAGAGAACTGTGTTTACTGATAAAGTGTCTGTCCCAAA ACTTAAGAAAAATACCAAAGAAAGTCATTTTCTCAGAAGGTTTCCATCCACCA

A GACGCCTCCCTTCAGCTCGGAAGAGGAGCCAGATGAAGAGGACCTCCTCCATGCTTACCTCTCCCCAGACTCACTTGCCACCGCTGCCACACAGCCAC

CTAAAAGCAGCATGAGTCACTTTGGAAAGAGCGCTGTCAAAAGTGACACGGACTGGACGGAGGGAAGTGAAATGGATGACTCGGACTTCTCTCCTAAGCT

GACAG GAACCTCCATTACGATACAGACTGACACTGTTGAGACCATGGCTTTACCCCAAGGAAGTGGGAATAAAGCAGTGCCGGGAATGAACCCTGCTGA

CACGGTTATCAAAAAGGAATCGTTGCAAGAGTTAAAG TGCACAGATGCTGATGACGAGGACTGGGATATATCGTCCTTAGAGGAAGAGAAGTCTCTGGG

GAGTAAAATAGAGCAGAGGGAGCCGCCTCCGGCCAAGCGGGACCCCAGCTGCACCCAGGTGCAGAGGGCCTGGGGCCCAGTGAACCCTCGGGAATTCAAG

GAAGAAG GACTTCATGAAAACGAACCGAGCACACTCAAGAGCAACTTAGTCACTGTGACTGACTGGAGCGATGTCCTGGATGTCTAAGCACGGCCTCGC

ACATCGGAAGCCTGTGCCGAGGCCGCCAGCATCAGTGCAGTCAACAGCCTATAGGACTCTAATGCTCTTAGTGTTTCCAACCATAGCAAGGAAGCCGGTT

CTGAACAAGGGTGTCTCTTATGACACGTAACACAGTGCCGAGAACAAACTGTCAGCTGTCCACTGTGTAAAAACAACGTATCCTTTAAGTCATAAAAACT

CTTTTCTTCAGTACAGAACTCTCTAGTGTTAAATGTATTTTTTTTCGACTAACTTTTAAGTCTTTTTTTTTTTTTGACTGATAGCAGGCTTCAGTTTGAA

TTACTATAGCTCTTTAAAATATATATGTACTGTCCCATTGGTAGTTCTTATGTTAAAACAATCCTGTCGTCTCTTCAAACTGAATTAGCGAACTCAATGA

TCCCATGAATGGTAACAGTTAGCTAGGCCCATGGTAAATACATTTCCTTAAAAGTCCCTTTGATCCCACTGAGCTCTGAGGCCCTGTCAGCATGCCGTTA

CTAACGAGTTCTTTTCTGCAGTGTAACCTTCATCTTGGATGTTTTATGAATAATGTGCAGCTGTTGTAACTGCCAATTGATTCCTGTGAGATGGTCACTA

GAAAAAGATGAGCCGTTATTAAGTCACCCACATGTCATTTTCCTGTGTTCAGTCCCCAGCCCATAGTATAAAATACCTCAGAACTAATTTATATTCTTGA

ATAATGATCTTGGCAATGATCAGAAAGTTTATATAGGAATTGTTTGGGTTTTTTTTTTCTTTTTAAACTTTTTTCCTTTTTTAAAAAAATATTTTTTATA

CTTTGTAGAACTATTAGGACTATCTCCAAAAACAAAAAAGGAACCTATTAATGGCTTGTTGATTTGGGGTCTCCTGTCATTCACCTACTGTACCAGTAAA

GTCCTCCATC
Translation
 - UNI26394 -  M PFQKHVYYPLANSPEGPDASAIGAAPMAFVPPSAASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFC

KLEDEKCPHCQSGVDPVLLKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEECKRRKKMLSTQQLMIEAKASYYQ

 CHFCDKAFMNQAFLQSHIQRRHTEDSHLE EYNTKAQTDRLQKEIDMLKEQLQLTRSQLESAQHSHAVRFSK DYEMQKSKEEDFLKLFDRWKEEEKEK

LLEEMEKVKGMFMREFKELTSKNSALEY QLLEIQKSNIQIKSNIGTLRDVTELREDHLPCPQDFQNMLQLLDSQ ASKWTDRFQVLNEEHSKEKGQ LL

SHIEKLRSSMMKDLSADNVFYKRRVEELGQKLQEQNELIISQKQQ IREFASKPYSSISELKG GTPLTRQTLEPKSAAPTTPM MTASATQNLDGASSL

TMVHE EQVFSSHILEPIEELSSEEEKG GRENEQKLNKKTSLRKPSSTSPSPQELRTNLERELGNKLRSFGIGA NIQGIPCEILNRSLKAMQVARHDL

AKQMPDIQQIRESLEHQLICKMEEKVSLSSD DRHHVPSMTTFPPEEVPKATQLPHKSRPLVRQRTVFTDKVSVPK KLKKNTKESHFLRRFPSTK KTP

PFSSEEEPDEEDLLHAYLSPDSLATAATQPPKSSMSHFGKSAVKSDTDWTEGSEMDDSDFSPKLTG GTSITIQTDTVETMALPQGSGNKAVPGMNPADT

VIKKESLQELK CTDADDEDWDISSLEEEKSLGSKIEQREPPPAKRDPSCTQVQRAWGPVNPREFKEEG GLHENEPSTLKSNLVTVTDWSDVLDV

For any suggestions or comments, please send an email to unitrap@crg.es