Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042167 (Papd4)
Chromosomal location
Chr 13: 93917355 - 93962238 (-)
Description
PAP associated domain containing 4 Gene [Source:MGI Symbol;Acc:MGI:2140950]
RefSeq_dna
NM_133905 
RefSeq_peptide
NP_598666.1 
MGI
MGI:2140950 
Uniprot/SWISSPROT
Q91YI6 
Human Ortholog
ENSG00000164329 (PAPD4)
Omim not available
UniTrap UNI2225
Vector Insertion
Chr 13: 93956432 - 93962048
Public Clones (sanger) BA0499 (sanger) P134C02 (ggtc) H011E05 (ggtc) E055A03 (ggtc)
P123C07 (ggtc) H004G03 (ggtc) D001G12 (ggtc) 5SP123C07 (ggtc) H003G06 (ggtc)
IST14757B6 (tigm) IST14515F11 (tigm)
Private Clones OST466724 (lexicon) OST418245 (lexicon) OST415097 (lexicon) OST311362 (lexicon)
OST303585 (lexicon) OST302922 (lexicon) OST282164 (lexicon) OST268844 (lexicon)
OST257803 (lexicon) OST248010 (lexicon) OST243748 (lexicon) OST242829 (lexicon)
OST210373 (lexicon) OST201997 (lexicon) OST197204 (lexicon) OST185654 (lexicon)
OST162260 (lexicon) OST157613 (lexicon) OST149303 (lexicon) OST147380 (lexicon)
OST134460 (lexicon) OST132538 (lexicon) OST118157 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17865
Vector Insertion
Chr 13: 93955853 - 93956257
Public Clones not available
Private Clones OST434672 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19560
Vector Insertion
Chr 13: 93954272 - 93955762
Public Clones not available
Private Clones OST388908 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8487
Vector Insertion
Chr 13: 93945768 - 93954033
Public Clones RRO030 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048702
Sequence
GCCTTCCACGGCCGCGCGGGCCTGGCCTTAGGCTCGTGACTCTCCGCCGCCCTGCCCGCCCGAGCTGGGCCTCGCTGCGCCGGGCCGCTGGCTGCTCCTA

CCTCTGCCTGCTCGGGCGGCAGCTCCGGCCTGGGAGCGTGTTGGCGGGCAGTGCCGCTGGGCCCCGCTCGGCCCTTCGGCGTGGACGCCG - UNI2225

 - GTAGAAGAATACATGTTTACCTTTAGTGAACAAGAGCATGTTCCCAAACTCAATTTTGGGTCGTCCACCCTTCACTCCAACCCACCAACAGCATAAT

AACTTCTTTGCTCTCTCACCAACTCTTTATTCACACCAGCAACTTATAGATGCACAATTCAACTTTCAAAATGTAGA - UNI17865 - CTTGTCTAG

AGCTGTGTCCTTACAGCCCCTGACATATGGAACTGTCAGTCCAATACAGACCTCAACATCTCCATTATTTCGAGGAAGGAA - UNI19560 - GAGAA

TAAGCGATGAAAAAGCTTTTCCTCTTGATGGTAAACGGCAGCGTTTCCATTCACCCCACCAAGAGCCAACTATAATCAACCAGCTAGTGCCTTTATCAGG

TGACAGAAGATATTCCATGCCACCGTTGTTTCACACGCACTATATACCAGATATAGTCAGATGTGTTCCACCTCTTCGAGAAATTCCACTGTTAGAACCT

CGAGAAATCACACTGCCTGAGGCCAAAGATAAG - UNI8487 - TTGAGTCAGCAGATACTAGAGTTGTTTGAAACTTGTCAGCAGCAAGCAAGTGAC

TTGAAGAAGAAAGAACTCTGTAGAGCACAGCTGCAGAGAGAGATCCAGCTGCTCTTCCCAC AAAGCAGACTTTTTCTCGTTGGATCATCTTTGAATGGA

TTTGGTGCCCGAAGCAGTGATGGCGATTTATGCTTAGTTGTTAAAGAAGAACCA TGTTTTTTCCAGGTAAATCAGAAGACTGAAGCACGACATATACTC

ACCTTAGTCCATAAGCACTTCTGTACTAGACTGT CTGGCTATATTGAGAGACCTCAGCTGATTCGAGCAAAAGTGCCAATTGTGAAGTTCAGGGATAAA

GTCAG TTGTGTGGAATTCGACTTAAATGTAAACAATACCGTTGGAATTAGAAATACATTCCTTCTCAGAACCTATGCATACC TTGAAAATCGAGTTCG

TCCATTAGTGCTGGTGATTAAGAAGTGGGCAAGTCACCATGACATCAATGATGCCAGTCGTGGCACATTAAGCAGCTATAGTCTTGTATTGATGGTTTTG

CACTATTTACAAA CCCTACCTGAACCCATCCTTCCATCCCTCCAAAAAATTTACCCA GAATCATTTAGTACTTCTGTCCAGCTGCACCTTGTTCATCA

TGCCCCATGTAATGTCCCTCCTTACCTCTCAAAGAATGAATCAAGTCTTGGGGACCTCTTACTGGGCTTTCTGAAATATTATGCTACAGAATTTGA CTG

GAACACTCAGATGATTTCAGTTCGTGAAGCCAAAGCCATCCCAAGGCCTGATGATATGGAATGGAGAAATAAATACATCTGTGTTGAAG AACCTTTTGA

TGGAACTAATACCGCCAGAGCTGTGCATGAGAAGCAGAAGTTTGATATGATCAAGGATCAATTTTTAAAG TCATGGCAGAGATTGAAAAACAAGAGAGA

TCTGAACAGTGTGCTGCCTTTGAGAGCTGCTACCCTGAAAAGATAACTGGTCTCTAATTCTTCAATTCTTCCAAGAAATAAAGAACAACAGATCTATCAT

AATTCATTTTGTTTACCTCCATCATGGTTTATTTTTAATGTTCTTGTTTTCATGTTTTATTTTTAAAAGGACATATATAAAGATTGCATATTTTATTATG

ACATTTCCTAATAAACTCTTTGATTTAAGAAAATGTA
Translation
 - UNI2225 - MFPNSILGRPPFTPTHQQHNNFFALSPTLYSHQQLIDAQFNFQNVD - UNI17865 - DLSRAVSLQPLTYGTVSPIQTSTSPLF

RGRK - UNI19560 - KRISDEKAFPLDGKRQRFHSPHQEPTIINQLVPLSGDRRYSMPPLFHTHYIPDIVRCVPPLREIPLLEPREITLPEAKDK -

 UNI8487 - LSQQILELFETCQQQASDLKKKELCRAQLQREIQLLFPQ QSRLFLVGSSLNGFGARSSDGDLCLVVKEEP CFFQVNQKTEARHILTL

VHKHFCTRLS SGYIERPQLIRAKVPIVKFRDKVS SCVEFDLNVNNTVGIRNTFLLRTYAYL LENRVRPLVLVIKKWASHHDINDASRGTLSSYSLVL

MVLHYLQT TLPEPILPSLQKIYP ESFSTSVQLHLVHHAPCNVPPYLSKNESSLGDLLLGFLKYYATEFD DWNTQMISVREAKAIPRPDDMEWRNKYI

CVEE EPFDGTNTARAVHEKQKFDMIKDQFLK SWQRLKNKRDLNSVLPLRAATLKR

For any suggestions or comments, please send an email to unitrap@crg.es