Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042198 (Chchd7)
Chromosomal location
Chr 4: 3866035 - 3870675 (+)
Description
coiled-coil-helix-coiled-coil-helix domain containing 7 Gene [Source:MGI (curated);Acc:Chchd7-010]
RefSeq_dna
NM_181391 
RefSeq_peptide
NP_852056.1 
UniGene
Mm.27406 
MGI
MGI:1913683 
Uniprot/SWISSPROT
Q8K2Q5 
Uniprot/SPTREMBL
B1AXC5 Q3TFT3 B1AXC7 B1AXC8 B1AXC9 Q8BT77 
Human Ortholog
ENSG00000170791 (CHCHD7)
Omim not available
UniTrap UNI27419
Vector Insertion
Chr 4: 3868459 - 3869867
Public Clones not available
Private Clones OST60074 (lexicon) OST54205 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121210
Sequence
GTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTG ACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGTTCAGTAACGTGCCC

TTCCCCCACTGCGGATCAAAGCTGCGAAGAGTGGGAAATCAGGAACTTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCGGCTGAGAGATCCTG

ACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTAC

TTCTTGAAGTACAAAAACTGCCGGCGATTCTGGGTAAGCCCAACTTCTCAAGCTTCTTAGGCTTGTGGCCGTAGCTGAGAATAACCAGTAATCCACAGTT

TCCCAGTGATGGCTGTAGGTACACTTACTCTTTGACCTTATCTTCTGAGTGGGATTTTAGTTCTGTGGCATCCTTGAGCGCTTGTTTCATTCTTTTCCAA

GGTTTAAGACTCAACCTTTAATATCAATAAGTCTTCCTAGGTGAGTATCTTTAGTCATAAAATA
Translation
  MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFWVSPTSQAS
Transcript ENSMUST00000120732
Sequence
GTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTGGTGAGTGGTCTCCGGCCCCTCCCTCCCTGGACAGCAGGCCCGGGACAGCAC

TGCGCCGAGGGCAGACCCTAGTTCGTGGCGCCAAACCCTCCGCGGCGCGGCATGCTCCTGCCGCTACTCACGCCACGCGATTCGTCCGGCCGGGGCAGCG

GAAGGTGACCCCATGCAG GTTTATGGTGTGCTGTATTTCTGTTTCCGGATTTAACACTCACAGACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGT

TCAGTAACGTGCCCTTCCCCCACTGCGGATCAAAGCTGCGAAGAGTGGGAAATCAGGAACTTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCG

GCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAA

GGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCTGG GTTTAAGACTCAACCTTTAATATCAATAAGTCTTCCTAG AATTCTGTCATG

ATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGAGTATTTG

CATTAAAATTGTTTCTATAACTTGAAACA
Translation
  MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW V 
Transcript ENSMUST00000119403
Sequence
TTGACTTCCAATAGCTAATTGGCTCTTAGGGTAATGTGATGTCTTTAATGGATAAAACCTTTGCAAAGCTGTATTTTTAAGACTCAAATTGGAAAATTAC

TGAGCCACAGTAGCATTCTCTGACCTCCTTCAACCCATGGAAAGTATTAATCTACATAGAAGGTAGAAAGGGAATTGAAAAATTCATTCATTGTTTTTTT

AACTATGGCTTTTTAGAATGTTAAGTAAGCAGTAACTTGACTTTTGTTTGTGTGTGTTTCATTGTTTCCTATAGAGTACCTTCTACTTTGAAAATTAAAT

TTTGTGGGTAAATTAAATTAAAAGTACTTGTGGGGCTGATGACATTTTCTGGTCATTTCCTTCTGACCTGTTTTTCTGTCGCCTGCCTTCAGTAAGAAGA

CAAGATGCCCATGGTCACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCTTCTACCAGATGCATGG

ATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCTGG AATTCTGTCATGATCCAAAGAAGACAAA

ATGGAGTTCAGCCATCTATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGAGTATTTGCATTAAAATTGTTTCT

ATAACTTGAA
Translation
MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKMPY

Transcript ENSMUST00000119307
Sequence
GGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTGGTGAGTGGTCTCCGGCCCCTCCCTCCCTGGACAGCAGGCCCGGGACAGCACTGCGCC

GAGGGCAGACCCTAGTTCGTGGCGCCAAACCCTCCGCGGCGCGGCATGCTCCTGCCGCTACTCACGCCACGCGATTCGTCCGGCCGGGGCAGCGGAAGGT

GACCCCATGCAGGTCTGGGCACCCCGGATTGTGTCACTCCCCTCCTTGCCCTCCCCAGGTCCCCGCTCTACGCCGCCCCCTTCCTTCCCAGCCCCTTTTG

TGGTGTTTACCTGTGCCCGCCCTCCACCGTCCGATTCTGCGGCGCGGCACCTCGGAAGGCGGTGCGGTCCGGGAGTTACATTCTTGGAGATTCGTCTCCG

ACCTCTCAGATCCCTGTGATGTGTACTTTGACATTTTGTCCCTGGTACTCTGTACCCAGGTTTATGGTGTGCTGTATTTCTGTTTCCGGATTTAACACTC

ACAGACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGTTCAGTAACGTGCCCTTCCCCCACTGCGGATCAAAGCTGCGAAGAGTGGGAAATCAGGAAC

TTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCT

TCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCTGG AATTCTGTCATG

ATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGAGTATTTG

CATTA
Translation
 MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKMP

Y
Transcript ENSMUST00000121110
Sequence
AAGGTCCTGCTGCGTGAGCCACTGACGTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTG TAAGAAGACAAGATGCCCATGGTC

ACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGA

CAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCTGG AATTCTGTCATGATCCAAAGAAGACAAAATGGAGTTCAGCCATC

TATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGAGTATTTGCATTAAAATTGTTTCTATAACTTGAAACA
Translation
 MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKMP

Y
Transcript ENSMUST00000121651
Sequence
GTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTGGTGAGTGGTCTCCGGCCCCTCCCTCCCTGGACAGCAGGCCCGGGACAGCAC

TGCGCCGAGGGCAGACCCTAGTTCGTGGCGCCAAACCCTCCGCGGCGCGGCATGCTCCTGCCGCTACTCACGCCACGCGATTCGTCCGGCCGGGGCAGCG

GAAGGTGACCCCATGCAG ACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGTTCAGTAACGTGCCCTTCCCCCACTGCGGATCAAAGCTGCGAAGAG

TGGGAAATCAGGAACTTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419

 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCT

GG AATTCTGTCATGATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGC

CCTACTGAGTATTTGCATTAAAATTGTTTCTATAACT
Translation
  MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKM

PY
Transcript ENSMUST00000108386
Sequence
AAGGTCCTGCTGCGTGAGCCACTGACGTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTG GTTTATGGTGTGCTGTATTTCTGT

TTCCGGATTTAACACTCACAGACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGTTCAGTAACGTGCCCTTCCCCCACTGCGGATCAAAGCTGCGAAG

AGTGGGAAATCAGGAACTTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCGGCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI274

19 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAAGGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATT

CTGG AATTCTGTCATGATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTACAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGAT

GCCCTACTGAGTATTTGCATTAAAATTGTTTCTATAACTTG
Translation
  MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKM

PY
Transcript ENSMUST00000041122
Sequence
GTGTTTGGAACTGCAGCCGGCCCGGGTGCTGGCTGAGTGGTGGCCTGTGGTGAGTGGTCTCCGGCCCCTCCCTCCCTGGACAGCAGGCCCGGGACAGCAC

TGCGCCGAGGGCAGACCCTAGTTCGTGGCGCCAAACCCTCCGCGGCGCGGCATGCTCCTGCCGCTACTCACGCCACGCGATTCGTCCGGCCGGGGCAGCG

GAAGGTGACCCCATGCAG GTTTATGGTGTGCTGTATTTCTGTTTCCGGATTTAACACTCACAGACCAGACTCTGAGAAGCCTGGGGGGCCTGGACTTGT

TCAGTAACGTGCCCTTCCCCCACTGCGGATCAAAGCTGCGAAGAGTGGGAAATCAGGAACTTTTTTG TAAGAAGACAAGATGCCCATGGTCACTCGGCG

GCTGAGAGATCCTGACATAAACCCTTGCTTGTCG - UNI27419 - GAATCTGATGCTTCTACCAGATGCATGGATGAAAATAACTATGACAGGGAAA

GGTGTTCCAGTTACTTCTTGAAGTACAAAAACTGCCGGCGATTCTGG AATTCTGTCATGATCCAAAGAAGACAAAATGGAGTTCAGCCATCTATGCCTA

CAGCAGCAGAAAGAGACGAAATTTTGGGAGCAATGCAAAAGATGCCCTACTGAGTATTTGCATTAAAATTGTTTCTATAACTTG
Translation
  MPMVTRRLRDPDINPCLS - UNI27419 - ESDASTRCMDENNYDRERCSSYFLKYKNCRRFW NSVMIQRRQNGVQPSMPTAAERDEILGAMQKM

PY

For any suggestions or comments, please send an email to unitrap@crg.es