Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042202 (A530082C11Rik)
Chromosomal location
Chr 4: 154975525 - 155084606 (+)
Description
RIKEN cDNA A530082C11 gene Gene [Source:MGI Symbol;Acc:MGI:2444240]
RefSeq_dna
NM_177186 
RefSeq_peptide
NP_796160.1 
UniGene
Mm.394748 Mm.398036 Mm.306018 
MGI
MGI:2444240 
Uniprot/SWISSPROT
Q8C811 
Human Ortholog
ENSG00000189339 (AL691432.53-202)
Omim not available
UniTrap UNI22338
Vector Insertion
Chr 4: 154983947 - 154984429
Public Clones not available
Private Clones OST299860 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30506
Vector Insertion
Chr 4: 154997450 - 155084560
Public Clones (sanger) PST21327-NR (escells) IST11227B7HMF1 (tigm) IST14955A8 (tigm)
IST13197D11 (tigm) IST14569F6 (tigm) IST15026E10 (tigm) IST13754G10 (tigm)
IST14635A7 (tigm) IST10699D11 (tigm) IST13055F4 (tigm) IST10771A9 (tigm)
IST10990E3 (tigm) IST14224B5 (tigm) IST15028H11 (tigm) IST12669H4 (tigm)
IST11226E6 (tigm) IST11554H11 (tigm) IST12135C1 (tigm) IST14759E11 (tigm)
IST14250H10 (tigm) IST13352G11 (tigm) IST13805G5 (tigm) IST11508G12 (tigm)
IST10963B4 (tigm) IST15089E6 (tigm) IST14312C11 (tigm) IST11409G1 (tigm)
IST13945F11 (tigm) IST10230D9 (tigm) IST10673A11 (tigm) IST14857D4 (tigm)
IST14056H7 (tigm) IST14733C8 (tigm) IST14027E3 (tigm) IST12716E1 (tigm)
IST13061C6 (tigm) IST12468B6 (tigm) IST14239A8 (tigm) IST13401C6 (tigm)
IST12380A4 (tigm) IST12088H12 (tigm) IST10937H1 (tigm) IST12749G9 (tigm)
IST11571F5 (tigm) IST14204D4 (tigm) IST13424C12 (tigm) IST14951G5 (tigm)
IST11564F12 (tigm) IST12744E5 (tigm) IST11938C1 (tigm) IST12738F8 (tigm)
IST11976H11 (tigm) IST14569G2 (tigm) IST13510E6 (tigm) IST12648D1 (tigm)
IST12812D7 (tigm) IST10795H12 (tigm) IST10029G10 (tigm) IST11653H12 (tigm)
IST14444G7 (tigm) IST10550D3 (tigm) IST14472H9 (tigm) IST11626G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116253
Sequence
GGGGGTTCCTCGCACGTTCGCCACTGAGCGCTTCTCGTCTTGTGACTTTCTGGTCAGATTTTAGGATCCTTGAAATCAAGCCCCTGGGTCTGACCTAGAG

GGCGGCACCTTCGCGGCCTCAGAGGATTGGCTCCTTCACCTTGGTCTCGGTGGAACGTTCCGGAATGTACCACAGGCCAGAGGAGCGACACCTGCACGCT

GGCCCAGCATGGCGGACCCCGCAGAGGTGGGACGCTCCGGAGGCGCCCACAGGAGGCCGCAAGGCGGTGCTGTGGCCCCGCATCGTCGCCCGCCCCGTGG

TTTGCGGTGGGCCGCTACGGAAG - UNI22338 - CCTTTGCTTCCTTACTTTGCTGGAGACCAGCATGCTGGAGTCAACATTCAAGCAGACCAGGAC

TGCTGCCTCTTCCTCCAGCTGTGTCTCTCTGTCTGCGCAGTTGCTTTGATCCATGTGGGCCGTCTTTGAGATTCCCTCCTCGAAAGCGCCCTCAGCATGT

CAGCAGCAGCGAAATCCCAAGTGCCGGAGGAGGCAGCGCCTGGCTGCGAGGAAGAGCCCAAGGGAAAAACACTTCTCACTTGGGGGTCTCTATTTGGTCA

CCGAAGTGAGAAGATTGTCTTTACCAAAGGTGATGGCAGCCCAGAGGAGAGCTTGCTCACTGTCACCATCACAGAGACCACTGTCATTGAGTCGGATCTG

GGTGTGTGGAGTTCAAGGGCTCTCATCTACCTCACACTGTGGTTCTTCTTCAGCTTCTGTACACTGTTCCTCAACAAATACATCCTGTCCCTGTTAGAGG

GAGAGCCCAGCATGTTAG - UNI22338 - GTGCTGTGCAGATGCTGTCAACAACGTTAATTGGATGTGTTAAAATATTTGTTCCTTGCTGTTTATAT

CAACACAAAACCCGGCTTTCTTACCCACCCAATTTCATCATGACTATGCTCTTTGTGGGCCTCATGAG GTTTGCAACGGTGGTTTTGGGGCTGGTCAGC

CTCAAGAATGTGGCAGTGTCCTTTGCTGAGACAGTGAAGAGCTCGGCTCCCATTTTCACGGTGATCATGTCTCGGATGATTCTGGGGGAGTACACAG GG

CTGCTGGTCAACCTGTCCCTCATTCCAGTCATGGGAGGACTAGCGTTGTGCACTGCCACGGAAATAAGCTTCAACATCCTGGGGTTTTCAGCTGCGTTAT

CCACCAACATTATGGATTG TTTGCAGAATGTTTTTTCAAAAAAGCTTCTCAGTGGGGACAAATACCGGTTCTC GGCCCCGGAACTGCAGTTCTACACC

AGTGCTGCTGCTGTGGCCTTGCTCATTCCAGCATGGACCTTCTTCATG GATATCCCTGTGATTGGAAGGAGTGGGAAGAGCTTCAGCTACAGCCAGGAC

ATCGTGCTGTTGCTGCTGACAGATGGCGCCTTGTTTCACCTTCAGAGTGTCACTGCATATGCCCTGATGGGAAAGATCTCCCCTGTGACGTTCAG TGTC

GCCAGTACTGTGAAGCACGCCTTGTCTATCTGGCTCAGCATCATCGTTTTTGGAAACAAAATCACTAGCCTGTCTGCCATTGGCACCATCCTTGTCACAT

TGGGTGTCTTGCTCTACAACAAGGCCAGGCAGTATCAGCAGGAGACTATGCAGAGTCTGGTCACAGCCACCAGCCGAAACCCAGAAGATGACACAGAGCC

CCTTGTTCCCCAGGACTCTAGACAGCACCACTGATCACCTGATGCTGTGTAGATCCAGGCCTAGATGTTCCTTCTGTACTAGAGGGAAATGATGCAGGGC

AGGTCTCTCGCTCCTTCCTGGAAATCAGATGGGGAATTTGGGACTCAGCTTCTGCCTGGCAGAGCACCACAGGACCAAATGATCTACAGCTTCCCTGGCT

GCAAGTGAACCAGTGTCTCCGTGCCCAGCCTGCACTGTGGAATAAGCACAGGCTCCAGGATCAACCCGAGTTGCTGTCTGTTTGATGCCATCCAGGAGAC

CTAAACTTTTCTATCACCACCACCACCACCACCACCACCACCATGGAAGCCTCTTGGTTCTTGACAGTCTATGAAACAGACATTCCAGATGCCAATGACT

CTAGCATGGAGCCATAAAACCCAGAGTAGCAGGCAGAAGAGACAAGTTTCTCCTGCCACGGAGAGACAGTGCTGTGTGAAGGAGAAGTGTCTCCTCCTTG

GCCTGTGCTACATTGAACTACCCTGCTCCAGGGTTGTTGTCCCATGTTTCTGCTACCATTTTGTGATTGCCCATTCTGGGAAGTTGGCAGCAAATCTCTA

ATTCAAGCAGATGGTCTGGAGTGCTTTTCCATTTTAAGTATGTGAATGTGAAGCGGGCGATTCTGAATGGCACAGTGGCTGCCCTATGAAGATTTCCCTT

CAGGATGCTTGATAGGGACGTTCTGACGAGCATTTGAGTGTTTATAGGCTATGCTGTAGTTAAAGGGACACTTCTTTTTGATGTAGCAGGTGCCTGTCGA

GGTTTCTCTGTGTCTCCATGTAAGGTACATCAAAGTGTACATGCACAACTAACTCTTCACCAGGGATCATATGATGACTGCCTGAGCCACCAGGTCTCCA

GAGCTTAAGGTGGAGTGGAGGACAACAGTGGGCCTTGGGTTAACACGCTGAGGTTCTACATTATTCGGCATTTTGTGAGTTGTGTGTGGGGTGCAGTCTG

TTGCTAGCCAGTCTCTAAGACTCCATTACTTACAAGCTGCAGCCACTGGCACTCCTTGTCCAGGTCTCACTGGTCCTCCCTGCTCTAAGTCTTTCGTGCA

CATGGTGGTTCAAAAAGATAATGGGGTGAAAAAGAGCAATAATTATGTCTACATTTTATTTACTTGAAAAAGCCATCTGCCATGATGATGGATCAAAATG

AGGCCTTTTAATCCATAAGCCAACTTTTAAAAGAAGCTGATGTGTGCTGGACATCAGCTAGGTGTATCTTTACTATGCTATGTAAAGATATTGTGAAGAT

GTTCTCTCATTTGACTTTGCCCAGGTTTCTAGTTCCTTCCTCTTTGCTCTTCTCAAAATAAAGATCCAGTGGAGGACAGATGGCAGACGTTGGATTAATC

TGTGTAGACCTGTCTGCTCAAGATCTGGCTGTGGAGCTGCTGACACCGAAGAGCACGTGCTTGTGGGTATTGGTTGGCAGAGCTCTTCTGGCCTTCCCGC

AGACCTGTCTAAGTATGCTCAGAGCTCTACATGCCTGGCTTCTTACTATTATTTGGAATTTCTGCCTGTGTCCTATGTTTAATTAGGAAATGACCTATTG

TGACTTGCTCTGGCCATCCCTCCCCCATGTCACAAGACTCAGCTTGTTTTGATTTTCTTAAGGTTTGGGCTAGAAACAAAAACAAAGATTTTTCTTAAAG

CAATTTTCTCTAAAGCTGCTTTGAGACTTTTCCTCATAGGTGGAAAGATCATGGAATCAGCTGCTTCCTTCAGGTCTTCCAGGACAGGGCTGGGTTGAGA

ATCGTGGAACGGCCCTGCTTGACCATTTGTTATGACTATACCATAACAATACATTTTTAATTGACTTTGTTAGTACTTTCATAGAATACTATGTTCTTCA

TGAATTGTTACTGATGTAAATGTACAAATATTGACACCACGTGTCATTCCTTGTCCTGGATAATTCCTCCTGAGTTTATGTCATTGTCTGGTCTGTTGTA

AACAGAACACTGGATTGACCTTCTGAGCCAGCTAGCTGCTTACTCACTGCACGCATAGTTAAAAGATATACACATTTCTAATTTCAAAAATAGTTCTAGG

AGCTACAGAGATGGCCGAGTGGTTATGTTTCTTGCTGAGGACCCAAGTTCAGTTCCCAGAACTCATGTAGAGTGTTTCACCAACTTCCTATAACTTCAGC

ATTAGGGATTCTAATGCCTCTGGCTTCTCTGGGCATCTGCACACTGGCTTGTGTATGAACACACACACATATACACACACACATATATCTTAAAAATAAG

TACATTTGCTAGG - UNI30506 - ATTTGTGTGCACCACCACTGCCCAGCAAGAACAAATATTCTTAACT
Translation
 - UNI22338 - MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFS

FCTLFLNKYILSLLEGEPSMLG - UNI22338 - GAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMR RFATVVLGLVSLKNVAV

SFAETVKSSAPIFTVIMSRMILGEYTG GLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDC CLQNVFSKKLLSGDKYRFS SAPELQFYTS

AAAVALLIPAWTFFM DIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFS SVASTVKHALSIWLSIIVFGNKITSLSAIGTILV

TLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH - UNI30506 - 
Transcript ENSMUST00000105606
Sequence
GGGGGTTCCTCGCACGTTCGCCACTGAGCGCTTCTCGTCTTGTGACTTTCTGGTCAGATTTTAGGATCCTTGAAATCAAGCCCCTGGGTCTGACCTAGAG

GGCGGCACCTTCGCGGCCTCAGAGGATTGGCTCCTTCACCTTGGTCTCGGTGGAACGTTCCGGAATGTACCACAGGCCAGAGGAGCGACACCTGCACGCT

GGCCCAGCATGGCGGACCCCGCAGAGGTGGGACGCTCCGGAGGCGCCCACAGGAGGCCGCAAGGCGGTGCTGTGGCCCCGCATCGTCGCCCGCCCCGTGG

TTTGCGGTGGGCCGCTACGGAAG - UNI22338 - CCTTTGCTTCCTTACTTTGCTGGAGACCAGCATGCTGGAGTCAACATTCAAGCAGACCAGGAC

TGCTGCCTCTTCCTCCAGCTGTGTCTCTCTGTCTGCGCAGTTGCTTTGATCCATGTGGGCCGTCTTTGAGATTCCCTCCTCGAAAGCGCCCTCAGCATGT

CAGCAGCAGCGAAATCCCAAGTGCCGGAGGAGGCAGCGCCTGGCTGCGAGGAAGAGCCCAAGGGAAAAACACTTCTCACTTGGGGGTCTCTATTTGGTCA

CCGAAGTGAGAAGATTGTCTTTACCAAAGGTGATGGCAGCCCAGAGGAGAGCTTGCTCACTGTCACCATCACAGAGACCACTGTCATTGAGTCGGATCTG

GGTGTGTGGAGTTCAAGGGCTCTCATCTACCTCACACTGTGGTTCTTCTTCAGCTTCTGTACACTGTTCCTCAACAAATACATCCTGTCCCTGTTAGAGG

GAGAGCCCAGCATGTTAG - UNI22338 - GTGCTGTGCAGATGCTGTCAACAACGTTAATTGGATGTGTTAAAATATTTGTTCCTTGCTGTTTATAT

CAACACAAAACCCGGCTTTCTTACCCACCCAATTTCATCATGACTATGCTCTTTGTGGGCCTCATGAG GTTTGCAACGGTGGTTTTGGGGCTGGTCAGC

CTCAAGAATGTGGCAGTGTCCTTTGCTGAGACAGTGAAGAGCTCGGCTCCCATTTTCACGGTGATCATGTCTCGGATGATTCTGGGGGAGTACACAG GG

CTGCTGGTCAACCTGTCCCTCATTCCAGTCATGGGAGGACTAGCGTTGTGCACTGCCACGGAAATAAGCTTCAACATCCTGGGGTTTTCAGCTGCGTTAT

CCACCAACATTATGGATTG TTTGCAGAATGTTTTTTCAAAAAAGCTTCTCAGTGGGGACAAATACCGGTTCTC GGCCCCGGAACTGCAGTTCTACACC

AGTGCTGCTGCTGTGGCCTTGCTCATTCCAGCATGGACCTTCTTCATG GATATCCCTGTGATTGGAAGGAGTGGGAAGAGCTTCAGCTACAGCCAGGAC

ATCGTGCTGTTGCTGCTGACAGATGGCGCCTTGTTTCACCTTCAGAGTGTCACTGCATATGCCCTGATGGGAAAGATCTCCCCTGTGACGTTCAG TGTC

GCCAGTACTGTGAAGCACGCCTTGTCTATCTGGCTCAGCATCATCGTTTTTGGAAACAAAATCACTAGCCTGTCTGCCATTGGCACCATCCTTGTCACAT

TGGGTGTCTTGCTCTACAACAAGGCCAGGCAGTATCAGCAGGAGACTATGCAGAGTCTGGTCACAGCCACCAGCCGAAACCCAGAAGATGACACAGAGCC

CCTTGTTCCCCAGGACTCTAGACAGCACCACTGATCACCTGATGCTGTGTAGATCCAGGCCTAGATGTTCCTTCTGTACTAGAGGGAAATGATGCAGGGC

AGGTCTCTCGCTCCTTCCTGGAAATCAGATGGGGAATTTGGGACTCAGCTTCTGCCTGGCAGAGCACCACAGGACCAAATGATCTACAGCTTCCCTGGCT

GCAAGTGAACCAGTGTCTCCGTGCCCAGCCTGCACTGTGGAATAAGCACAGGCTCCAGGATCAACCCGAGTTGCTGTCTGTTTGATGCCATCCAGGAGAC

CTAAACTTTTCTATCACCACCACCACCACCACCACCACCACCATGGAAGCCTCTTGGTTCTTGACAGTCTATGAAACAGACATTCCAGATGCCAATGACT

CTAGCATGGAGCCATAAAACCCAGAGTAGCAGGCAGAAGAGACAAGTTTCTCCTGCCACGGAGAGACAGTGCTGTGTGAAGGAGAAGTGTCTCCTCCTTG

GCCTGTGCTACATTGAACTACCCTGCTCCAGGGTTGTTGTCCCATGTTTCTGCTACCATTTTGTGATTGCCCATTCTGGGAAGTTGGCAGCAAATCTCTA

ATTCAAGCAGATGGTCTGGAGTGCTTTTCCATTTTAAGTATGTGAATGTGAAGCGGGCGATTCTGAATGGCACAGTGGCTGCCCTATGAAGATTTCCCTT

CAGGATGCTTGATAGGGACGTTCTGACGAGCATTTGAGTGTTTATAGGCTATGCTGTAGTTAAAGGGACACTTCTTTTTGATGTAGCAGGTGCCTGTCGA

GGTTTCTCTGTGTCTCCATGTAAGGTACATCAAAGTGTACATGCACAACTAACTCTTCACCAGGGATCATATGATGACTGCCTGAGCCACCAGGTCTCCA

GAGCTTAAGGTGGAGTGGAGGACAACAGTGGGCCTTGGGTTAACACGCTGAGGTTCTACATTATTCGGCATTTTGTGAGTTGTGTGTGGGGTGCAGTCTG

TTGCTAGCCAGTCTCTAAGACTCCATTACTTACAAGCTGCAGCCACTGGCACTCCTTGTCCAGGTCTCACTGGTCCTCCCTGCTCTAAGTCTTTCGTGCA

CATGGTGGTTCAAAAAGATAATGGGGTGAAAAAGAGCAATAATTATGTCTACATTTTATTTACTTGAAAAAGCCATCTGCCATGATGATGGATCAAAATG

AGGCCTTTTAATCCATAAGCCAACTTTTAAAAGAAGCTGATGTGTGCTGGACATCAGCTAGGTGTATCTTTACTATGCTATGTAAAGATATTGTGAAGAT

GTTCTCTCATTTGACTTTGCCCAGGTTTCTAGTTCCTTCCTCTTTGCTCTTCTCAAAATAAAGATCCAGTGGAGGACAGATGGCAGACGTTGGATTAATC

TGTGTAGACCTGTCTGCTCAAGATCTGGCTGTGGAGCTGCTGACACCGAAGAGCACGTGCTTGTGGGTATTGGTTGGCAGAGCTCTTCTGGCCTTCCCGC

AGACCTGTCTAAGTATGCTCAGAGCTCTACATGCCTGGCTTCTTACTATTATTTGGAATTTCTGCCTGTGTCCTATGTTTAATTAGGAAATGACCTATTG

TGACTTGCTCTGGCCATCCCTCCCCCATGTCACAAGACTCAGCTTGTTTTGATTTTCTTAAGGTTTGGGCTAGAAACAAAAACAAAGATTTTTCTTAAAG

CAATTTTCTCTAAAGCTGCTTTGAGACTTTTCCTCATAGGTGGAAAGATCATGGAATCAGCTGCTTCCTTCAGGTCTTCCAGGACAGGGCTGGGTTGAGA

ATCGTGGAACGGCCCTGCTTGACCATTTGTTATGACTATACCATAACAATACATTTTTAATTGACTTTGTTAGTACTTTCATAGAATACTATGTTCTTCA

TGAATTGTTACTGATGTAAATGTACAAATATTGACACCACGTGTCATTCCTTGTCCTGGATAATTCCTCCTGAGTTTATGTCATTGTCTGGTCTGTTGTA

AACAGAACACTGGATTGACCTTCTGAGCCAGCTAGCTGCTTACTCACTGCACGCATAGTTAAAAGATATACACATTTCTAATTTCAAAAATAGTTCTAGG

AGCTACAGAGATGGCCGAGTGGTTATGTTTCTTGCTGAGGACCCAAGTTCAGTTCCCAGAACTCATGTAGAGTGTTTCACCAACTTCCTATAACTTCAGC

ATTAGGGATTCTAATGCCTCTGGCTTCTCTGGGCATCTGCACACTGGCTTGTGTATGAACACACACACATATACACACACACATATATCTTAAAAATAAG

TACATTTG CTGGGATTAAAGGCGTGCGCCACCACTGCCCGGCCGGAAAGTATTTTTTTAATTCATTGTTTTGCCTGCATGTGTGTCTTTATGAGGGTGT

TGGATCCCCTGAAATTGGAGTTACAGATAATTATGAGCTGCCATGTTGCTCCTGGGAATTGAATTCGGGTCGTCTTGAAGATCAGCCATCTTACCAGCTC

CTGTTTTGTTTGTTTTTAAACCCGATCATGATGGCACATACATATAATCTTAGTAATTTGGAAGCATAAGAGTGCATAGTGGTTCAAGGCCAGCTTGGGC

TACATATTGAGACCAAGTTTCAAAAAAATGTTTATGATCACAATTTCTCAAATATTAGGATTATCATCTGTCTTCAGATGGTGGTTCACACTTTTAATC 

CCTCTGTCTCCCGAGTGCTAGGATTAAAGGCGTGCGCCACCACCGCCCAGCAAGTGATGTCTTCTTAACATTGGAAAGGGGTAAAGAAAGATGTTAGTAC

AGATGGGAAACAATGCCGGCTCCTCCTGAGATTGCATTTACCTATGTAACCCATAGTGTCCTTGAACTCTAGATTCTTCTAAGTCATCGTTCTCAGGACT

GAGATTACAAGTACGTGTCACCACTTCTGACTCCTGCCTTTGAACATCAATCTTTTGTTTTTTCTTAACACGTAAATATTGATCTCCCTGTGAGGCGGCC

TCTTCATCTCTTCATTCTCCCACCCTTCGTTTATTATGCTAGGCATAGTACTCAGGGCTTCAGGAATGCTAGGCTGCTATTCTTTCTCTGAGACATGGCC

TCCAGCCTGTTTTTCTTAGTTTATCAATGCCTTTGCTCTCCCCATGAATTAGAACAGGACATGCTGATTGTGGACAAATAGTATCCACCACAATTAGAGT

GTAGTAGGTTTTAACTTCAGTGTCTCTGAAGTACGTTTTCCTGGGTACTCTGATCCTGACTTTGCCAGCTGCTGGACCCTTCCTAATATGTCCAAGTTTA

GTTTGAATTAAATCAAGTTGGCTAGTTGTGTGTTTGTGGGGTTTTTGTTTGTTTTTACTTTTCATTTCTGGGACTCAAGCTGCATACTAAATTCATTTGT

AATGTCTGGACTTAATAATAATGTAATTGTGAGTATGTTCGTTCAATGTTCGTTCAATGTTGGCACTTTGGAAAAGGCCACAGTTTAGGGTGGACAATTG

TCTGCATCAAAGCCAAGTCATATTTGCTTTATACCAAACAATACTAGAGAATTAAAACACATCATAAAATGTACACTGTTTTGTATTTCACCTCTTTCAG

TATTTAAATAATTATATTAATGCCTCCTAGAAAAGAATTCTGTTAGATAATTCAGTGATTCCTGAAATAAATTGGTATTGTGTAATT
Translation
 - UNI22338 - MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFS

FCTLFLNKYILSLLEGEPSMLG - UNI22338 - GAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMR RFATVVLGLVSLKNVAV

SFAETVKSSAPIFTVIMSRMILGEYTG GLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDC CLQNVFSKKLLSGDKYRFS SAPELQFYTS

AAAVALLIPAWTFFM DIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFS SVASTVKHALSIWLSIIVFGNKITSLSAIGTILV

TLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH  
Transcript ENSMUST00000105608
Sequence
GGGGGTTCCTCGCACGTTCGCCACTGAGCGCTTCTCGTCTTGTGACTTTCTGGTCAGATTTTAGGATCCTTGAAATCAAGCCCCTGGGTCTGACCTAGAG

GGCGGCACCTTCGCGGCCTCAGAGGATTGGCTCCTTCACCTTGGTCTCGGTGGAACGTTCCGGAATGTACCACAGGCCAGAGGAGCGACACCTGCACGCT

GGCCCAGCATGGCGGACCCCGCAGAGGTGGGACGCTCCGGAGGCGCCCACAGGAGGCCGCAAGGCGGTGCTGTGGCCCCGCATCGTCGCCCGCCCCGTGG

TTTGCGGTGGGCCGCTACGGAAG - UNI22338 - CCTTTGCTTCCTTACTTTGCTGGAGACCAGCATGCTGGAGTCAACATTCAAGCAGACCAGGAC

TGCTGCCTCTTCCTCCAGCTGTGTCTCTCTGTCTGCGCAGTTGCTTTGATCCATGTGGGCCGTCTTTGAGATTCCCTCCTCGAAAGCGCCCTCAGCATGT

CAGCAGCAGCGAAATCCCAAGTGCCGGAGGAGGCAGCGCCTGGCTGCGAGGAAGAGCCCAAGGGAAAAACACTTCTCACTTGGGGGTCTCTATTTGGTCA

CCGAAGTGAGAAGATTGTCTTTACCAAAGGTGATGGCAGCCCAGAGGAGAGCTTGCTCACTGTCACCATCACAGAGACCACTGTCATTGAGTCGGATCTG

GGTGTGTGGAGTTCAAGGGCTCTCATCTACCTCACACTGTGGTTCTTCTTCAGCTTCTGTACACTGTTCCTCAACAAATACATCCTGTCCCTGTTAGAGG

GAGAGCCCAGCATGTTAG - UNI22338 - GTGCTGTGCAGATGCTGTCAACAACGTTAATTGGATGTGTTAAAATATTTGTTCCTTGCTGTTTATAT

CAACACAAAACCCGGCTTTCTTACCCACCCAATTTCATCATGACTATGCTCTTTGTGGGCCTCATGAG GTTTGCAACGGTGGTTTTGGGGCTGGTCAGC

CTCAAGAATGTGGCAGTGTCCTTTGCTGAGACAGTGAAGAGCTCGGCTCCCATTTTCACGGTGATCATGTCTCGGATGATTCTGGGGGAGTACACAG GG

CTGCTGGTCAACCTGTCCCTCATTCCAGTCATGGGAGGACTAGCGTTGTGCACTGCCACGGAAATAAGCTTCAACATCCTGGGGTTTTCAGCTGCGTTAT

CCACCAACATTATGGATTG TTTGCAGAATGTTTTTTCAAAAAAGCTTCTCAGTGGGGACAAATACCGGTTCTC GGCCCCGGAACTGCAGTTCTACACC

AGTGCTGCTGCTGTGGCCTTGCTCATTCCAGCATGGACCTTCTTCATG GATATCCCTGTGATTGGAAGGAGTGGGAAGAGCTTCAGCTACAGCCAGGAC

ATCGTGCTGTTGCTGCTGACAGATGGCGCCTTGTTTCACCTTCAGAGTGTCACTGCATATGCCCTGATGGGAAAGATCTCCCCTGTGACGTTCAG TGTC

GCCAGTACTGTGAAGCACGCCTTGTCTATCTGGCTCAGCATCATCGTTTTTGGAAACAAAATCACTAGCCTGTCTGCCATTGGCACCATCCTTGTCACAT

TGGGTGTCTTGCTCTACAACAAGGCCAGGCAGTATCAGCAGGAGACTATGCAGAGTCTGGTCACAGCCACCAGCCGAAACCCAGAAGATGACACAGAGCC

CCTTGTTCCCCAGGACTCTAGACAGCACCACTGATCACCTGATGCTGTGTAGATCCAGGCCTAGATGTTCCTTCTGTACTAGAGGGAAATGATGCAGGGC

AGGTCTCTCGCTCCTTCCTGGAAATCAGATGGGGAATTTGGGACTCAGCTTCTGCCTGGCAGAGCACCACAGGACCAAATGATCTACAGCTTCCCTGGCT

GCAAGTGAACCAGTGTCTCCGTGCCCAGCCTGCACTGTGGAATAAGCACAGGCTCCAGGATCAACCCGAGTTGCTGTCTGTTTGATGCCATCCAGGAGAC

CTAAACTTTTCTATCACCACCACCACCACCACCACCACCACCATGGAAGCCTCTTGGTTCTTGACAGTCTATGAAACAGACATTCCAGATGCCAATGACT

CTAGCATGGAGCCATAAAACCCAGAGTAGCAGGCAGAAGAGACAAGTTTCTCCTGCCACGGAGAGACAGTGCTGTGTGAAGGAGAAGTGTCTCCTCCTTG

GCCTGTGCTACATTGAACTACCCTGCTCCAGGGTTGTTGTCCCATGTTTCTGCTACCATTTTGTGATTGCCCATTCTGGGAAGTTGGCAGCAAATCTCTA

ATTCAAGCAGATGGTCTGGAGTGCTTTTCCATTTTAAGTATGTGAATGTGAAGCGGGCGATTCTGAATGGCACAGTGGCTGCCCTATGAAGATTTCCCTT

CAGGATGCTTGATAGGGACGTTCTGACGAGCATTTGAGTGTTTATAGGCTATGCTGTAGTTAAAGGGACACTTCTTTTTGATGTAGCAGGTGCCTGTCGA

GGTTTCTCTGTGTCTCCATGTAAGGTACATCAAAGTGTACATGCACAACTAACTCTTCACCAGGGATCATATGATGACTGCCTGAGCCACCAGGTCTCCA

GAGCTTAAGGTGGAGTGGAGGACAACAGTGGGCCTTGGGTTAACACGCTGAGGTTCTACATTATTCGGCATTTTGTGAGTTGTGTGTGGGGTGCAGTCTG

TTGCTAGCCAGTCTCTAAGACTCCATTACTTACAAGCTGCAGCCACTGGCACTCCTTGTCCAGGTCTCACTGGTCCTCCCTGCTCTAAGTCTTTCGTGCA

CATGGTGGTTCAAAAAGATAATGGGGTGAAAAAGAGCAATAATTATGTCTACATTTTATTTACTTGAAAAAGCCATCTGCCATGATGATGGATCAAAATG

AGGCCTTTTAATCCATAAGCCAACTTTTAAAAGAAGCTGATGTGTGCTGGACATCAGCTAGGTGTATCTTTACTATGCTATGTAAAGATATTGTGAAGAT

GTTCTCTCATTTGACTTTGCCCAGGTTTCTAGTTCCTTCCTCTTTGCTCTTCTCAAAATAAAGATCCAGTGGAGGACAGATGGCAGACGTTGGATTAATC

TGTGTAGACCTGTCTGCTCAAGATCTGGCTGTGGAGCTGCTGACACCGAAGAGCACGTGCTTGTGGGTATTGGTTGGCAGAGCTCTTCTGGCCTTCCCGC

AGACCTGTCTAAGTATGCTCAGAGCTCTACATGCCTGGCTTCTTACTATTATTTGGAATTTCTGCCTGTGTCCTATGTTTAATTAGGAAATGACCTATTG

TGACTTGCTCTGGCCATCCCTCCCCCATGTCACAAGACTCAGCTTGTTTTGATTTTCTTAAGGTTTGGGCTAGAAACAAAAACAAAGATTTTTCTTAAAG

CAATTTTCTCTAAAGCTGCTTTGAGACTTTTCCTCATAGGTGGAAAGATCATGGAATCAGCTGCTTCCTTCAGGTCTTCCAGGACAGGGCTGGGTTGAGA

ATCGTGGAACGGCCCTGCTTGACCATTTGTTATGACTATACCATAACAATACATTTTTAATTGACTTTGTTAGTACTTTCATAGAATACTATGTTCTTCA

TGAATTGTTACTGATGTAAATGTACAAATATTGACACCACGTGTCATTCCTTGTCCTGGATAATTCCTCCTGAGTTTATGTCATTGTCTGGTCTGTTGTA

AACAGAACACTGGATTGACCTTCTGAGCCAGCTAGCTGCTTACTCACTGCACGCATAGTTAAAAGATATACACATTTCTAATTTCAAAAATAGTTCTAGG

AGCTACAGAGATGGCCGAGTGGTTATGTTTCTTGCTGAGGACCCAAGTTCAGTTCCCAGAACTCATGTAGAGTGTTTCACCAACTTCCTATAACTTCAGC

ATTAGGGATTCTAATGCCTCTGGCTTCTCTGGGCATCTGCACACTGGCTTGTGTATGAACACACACACATATACACACACACATATATCTTAAAAATAAG

TACATTTGCTAGGGGAGGTGGTGCAAGCCTTTAATCCCAGCACTTGGGAATCAGAGGCATGTGGATCTCTGAGTTTGAGGGCAGTCTGGACTACAGAACA

AGTTCCAGGACAGCCAGGGCAACACAGAGAAAAGCCTGTCTTGAAAAACCAGATAAATAGATAAATAAAATTTAAAAACGTCCATGATTTGGGGTATACC

TTAGTGGCACATCACTGGCATGTATTGTGAAGCTCTTGGGTTGATCACCAGCAGCAGATGTGGGACAGAAAGATAAAGGGGAGACAACAAAAATAACCCC

AAAACTTCTAATACTAAAAGACAAGGAAACGTTTTTGTTTTTTGGGTTTTTTTGTTTTTTTTTTGTTTGGTTGGTTTTTTTTTTTTTTTTTTGGTTTTTC

AAGACAGGGTTTCTCTGTATAGTCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCGAACTCAGAAATCCGCCTGTCTCTGCCTCCCAAGT

GCTGGGATTAAAGGCGTGCGCCACCACTGCCCGGCCGGAAAGTATTTTTTTAATTCATTGTTTTGCCTGCATGTGTGTCTTTATGAGGGTGTTGGATCCC

CTGAAATTGGAGTTACAGATAATTATGAGCTGCCATGTTGCTCCTGGGAATTGAATTCGGGTCGTCTTGAAGATCAGCCATCTTACCAGCTCCTGTTTTG

TTTGTTTTTAAACCCGATCATGATGGCACATACATATAATCTTAGTAATTTGGAAGCATAAGAGTGCATAGTGGTTCAAGGCCAGCTTGGGCTACATATT

GAGACCAAGTTTCAAAAAAATGTTTATGATCACAATTTCTCAAATATTAGGATTATCATCTGTCTTCAGATGGTGGTTCACACTTTTAATCCCAGCACTT

AGGAGGCAGAGGCAGGTGATTCTCTGTGAGTTTGAGGCTAGACTGGTCTACAAAGCCAAATCCAGGACCCCCAGGGCTCTGTTACACAGAAAAACCTTGT

CTCAAGAAAAGTAAAAATGATGAGTCAGAGGAGATTAAAGAGAATTAAAGCTGTTCAAGGGATTCGGCCAAGTAAACTTTACTTTGTGCCTTAAAAACAG

CACAAAACAAGTGGCTTTGTGATCCTGCTCTCAGATGATCACTTTGCTCAGTGATAATAACAGATGCTCAGCACAGCCTCCTGTCACATCTGTCCAAGTG

ATGTCTTCTTTTTTTTTTTGTTGTTTTTTTTTGTTTTTTTTTTTTGTTTTTGGAGACAGGGTTTCTCTGTGTAGCCATGGCTGTCCTGGAACTCACTTTG

TAGACCAGGCTGGCCTCGAACTCAGAAATCCACCTGCCTCTGTCTCCCGAGTGCTAGGATTAAAGGCGTGCGCCACCACCGCCCAGCAAGTGATGTCTTC

TTAACATTGGAAAGGGGTAAAGAAAGATGTTAGTACAGATGGGAAACAATGCCGGCTCCTCCTGAGATTGCATTTACCTATGTAACCCATAGTGTCCTTG

AACTCTAGATTCTTCTAAGTCATCGTTCTCAGGACTGAGATTACAAGTACGTGTCACCACTTCTGACTCCTGCCTTTGAACATCAATCTTTTGTTTTTTC

TTAACACGTAAATATTGATCTCCCTGTGAGGCGGCCTCTTCATCTCTTCATTCTCCCACCCTTCGTTTATTATGCTAGGCATAGTACTCAGGGCTTCAGG

AATGCTAGGCTGCTATTCTTTCTCTGAGACATGGCCTCCAGCCTGTTTTTCTTAGTTTATCAATGCCTTTGCTCTCCCCATGAATTAGAACAGGACATGC

TGATTGTGGACAAATAGTATCCACCACAATTAGAGTGTAGTAGGTTTTAACTTCAGTGTCTCTGAAGTACGTTTTCCTGGGTACTCTGATCCTGACTTTG

CCAGCTGCTGGACCCTTCCTAATATGTCCAAGTTTAGTTTGAATTAAATCAAGTTGGCTAGTTGTGTGTTTGTGGGGTTTTTGTTTGTTTTTACTTTTCA

TTTCTGGGACTCAAGCTGCATACTAAATTCATTTGTAATGTCTGGACTTAATAATAATGTAATTGTGAGTATGTTCGTTCAATGTTCGTTCAATGTTGGC

ACTTTGGAAAAGGCCACAGTTTAGGGTGGACAATTGTCTGCATCAAAGCCAAGTCATATTTGCTTTATACCAAACAATACTAGAGAATTAAAACACATCA

TAAAATGTACACTGTTTTGTATTTCACCTCTTTCAGTATTTAAATAATTATATTAATGCCTCCTAGAAAAGAATTCTGTTAGATAATTCAGTGATTCCTG

AAATAAATTGGTATTGTGTAATTAA
Translation
 - UNI22338 - MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFS

FCTLFLNKYILSLLEGEPSMLG - UNI22338 - GAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMR RFATVVLGLVSLKNVAV

SFAETVKSSAPIFTVIMSRMILGEYTG GLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDC CLQNVFSKKLLSGDKYRFS SAPELQFYTS

AAAVALLIPAWTFFM DIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFS SVASTVKHALSIWLSIIVFGNKITSLSAIGTILV

TLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH
Transcript ENSMUST00000043829
Sequence
ACGCTGGCCCAGCATGGCGGACCCCGCAGAGGTGGGACGCTCCGGAGGCGCCCACAGGAGGCCGCAAGGCGGTGCTGTGGCCCCGCATCGTCGCCCGCCC

CGTGGTTTGCGGTGGGCCGCTACGGAAGGTGCGAACGCGCCGTGAGGGTGTCCTGGCTCCCCGTGGTGGGCCGCGGTGGAACGTTCTGGAAG - UNI22

338 - CCTTTGCTTCCTTACTTTGCTGGAGACCAGCATGCTGGAGTCAACATTCAAGCAGACCAGGACTGCTGCCTCTTCCTCCAGCTGTGTCTCTCTG

TCTGCGCAGTTGCTTTGATCCATGTGGGCCGTCTTTGAGATTCCCTCCTCGAAAGCGCCCTCAGCATGTCAGCAGCAGCGAAATCCCAAGTGCCGGAGGA

GGCAGCGCCTGGCTGCGAGGAAGAGCCCAAGGGAAAAACACTTCTCACTTGGGGGTCTCTATTTGGTCACCGAAGTGAGAAGATTGTCTTTACCAAAGGT

GATGGCAGCCCAGAGGAGAGCTTGCTCACTGTCACCATCACAGAGACCACTGTCATTGAGTCGGATCTGGGTGTGTGGAGTTCAAGGGCTCTCATCTACC

TCACACTGTGGTTCTTCTTCAGCTTCTGTACACTGTTCCTCAACAAATACATCCTGTCCCTGTTAGAGGGAGAGCCCAGCATGTTAG - UNI22338 -

 GTGCTGTGCAGATGCTGTCAACAACGTTAATTGGATGTGTTAAAATATTTGTTCCTTGCTGTTTATATCAACACAAAACCCGGCTTTCTTACCCACCCA

ATTTCATCATGACTATGCTCTTTGTGGGCCTCATGAG GTTTGCAACGGTGGTTTTGGGGCTGGTCAGCCTCAAGAATGTGGCAGTGTCCTTTGCTGAGA

CAGTGAAGAGCTCGGCTCCCATTTTCACGGTGATCATGTCTCGGATGATTCTGGGGGAGTACACAG GGCTGCTGGTCAACCTGTCCCTCATTCCAGTCA

TGGGAGGACTAGCGTTGTGCACTGCCACGGAAATAAGCTTCAACATCCTGGGGTTTTCAGCTGCGTTATCCACCAACATTATGGATTG TTTGCAGAATG

TTTTTTCAAAAAAGCTTCTCAGTGGGGACAAATACCGGTTCTC GGCCCCGGAACTGCAGTTCTACACCAGTGCTGCTGCTGTGGCCTTGCTCATTCCAG

CATGGACCTTCTTCATG GATATCCCTGTGATTGGAAGGAGTGGGAAGAGCTTCAGCTACAGCCAGGACATCGTGCTGTTGCTGCTGACAGATGGCGCCT

TGTTTCACCTTCAGAGTGTCACTGCATATGCCCTGATGGGAAAGATCTCCCCTGTGACGTTCAG TGTCGCCAGTACTGTGAAGCACGCCTTGTCTATCT

GGCTCAGCATCATCGTTTTTGGAAACAAAATCACTAGCCTGTCTGCCATTGGCACCATCCTTGTCACATTGGGTGTCTTGCTCTACAACAAGGCCAGGCA

GTATCAGCAGGAGACTATGCAGAGTCTGGTCACAGCCACCAGCCGAAACCCAGAAGATGACACAGAGCCCCTTGTTCCCCAGGACTCTAGACAGCACCAC

TGATCACCTGATGCTGTGTAGATCCAGGCCTAGATGTTCCTTCTGTACTAGAGGGAAATGATGCAGGGCAGGTCTCTCGCTCCTTCCTGGAAATCAGATG

GGGAATTTGGGACTCAGCTTCTGCCTGGCAGAGCACCACAGGACCAAATGATCTACAGCTTCCCTGGCTGCAAGTGAACCAGTGTCTCCGTGCCCAGCCT

GCACTGTGGAATAAGCACAGGCTCCAGGATCAACCCGAGTTGCTGTCTGTTTGATGCCATCCAGGAGACCTAAACTTTTCTATCACCACCACCACCACCA

CCACCACCACCATGGAAGCCTCTTGGTTCTTGACAGTCTATGAAACAGACATTCCAGATGCCAATGACTCTAGCATGGAGCCATAAAACCCAGAGTAGCA

GGCAGAAGAGACAAGTTTCTCCTGCCACGGAGAGACAGTGCTGTGTGAAGGAGAAGTGTCTCCTCCTTGGCCTGTGCTACATTGAACTACCCTGCTCCAG

GGTTGTTGTCCCATGTTTCTGCTACCATTTTGTGATTGCCCATTCTGGGAAGTTGGCAGCAAATCTCTAATTCAAGCAGATGGTCTGGAGTGCTTTTCCA

TTTTAAGTATGTGAATGTGAAGCGGGCGATTCTGAATGGCACAGTGGCTGCCCTATGAAGATTTCCCTTCAGGATGCTTGATAGGGACGTTCTGACGAGC

ATTTGAGTGTTTATAGGCTATGCTGTAGTTAAAGGGACACTTCTTTTTGATGTAGCAGGTGCCTGTCGAGGTTTCTCTGTGTCTCCATGTAAGGTACATC

AAAGTGTACATGCACAACTAACTCTTCACCAGGGATCATATGATGACTGCCTGAGCCACCAGGTCTCCAGAGCTTAAGGTGGAGTGGAGGACAACAGTGG

GCCTTGGGTTAACACGCTGAGGTTCTACATTATTCGGCATTTTGTGAGTTGTGTGTGGGGTGCAGTCTGTTGCTAGCCAGTCTCTAAGACTCCATTACTT

ACAAGCTGCAGCCACTGGCACTCCTTGTCCAGGTCTCACTGGTCCTCCCTGCTCTAAGTCTTTCGTGCACATGGTGGTTCAAAAAGATAATGGGGTGAAA

AAGAGCAATAATTATGTCTACATTTTATTTACTTGAAAAAGCCATCTGCCATGATGATGGATCAAAATGAGGCCTTTTAATCCATAAGCCAACTTTTAAA

AGAAGCTGATGTGTGCTGGACATCAGCTAGGTGTATCTTTACTATGCTATGTAAAGATATTGTGAAGATGTTCTCTCATTTGACTTTGCCCAGGTTTCTA

GTTCCTTCCTCTTTGCTCTTCTCAAAATAAAGATCCAGTGGAGG
Translation
 - UNI22338 - MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFS

FCTLFLNKYILSLLEGEPSMLG - UNI22338 - GAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMR RFATVVLGLVSLKNVAV

SFAETVKSSAPIFTVIMSRMILGEYTG GLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDC CLQNVFSKKLLSGDKYRFS SAPELQFYTS

AAAVALLIPAWTFFM DIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFS SVASTVKHALSIWLSIIVFGNKITSLSAIGTILV

TLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH
Transcript ENSMUST00000118607
Sequence
GGCTCTCGCCCTTGACTCTGGACCGCTCTGCCTAAAGCTGCTCGGCCCCGAGGCGGGCGCGGGCTGCATCTTCCGTGGGCGTGGGCTGAGGCTCTGCATA

AACTCCAGTGGCAGCCCCAGAACTGAACCCCATCGGGGGCCGGGGGCATCCCGTCCTGGAGTCAGCCCGGGTTGGCACCGGGCGCGCAGGTGGCGGGCTT

CGCCGGGCTGGACGCACAG - UNI22338 - CCTTTGCTTCCTTACTTTGCTGGAGACCAGCATGCTGGAGTCAACATTCAAGCAGACCAGGACTGCT

GCCTCTTCCTCCAGCTGTGTCTCTCTGTCTGCGCAGTTGCTTTGATCCATGTGGGCCGTCTTTGAGATTCCCTCCTCGAAAGCGCCCTCAGCATGTCAGC

AGCAGCGAAATCCCAAGTGCCGGAGGAGGCAGCGCCTGGCTGCGAGGAAGAGCCCAAGGGAAAAACACTTCTCACTTGGGGGTCTCTATTTGGTCACCGA

AGTGAGAAGATTGTCTTTACCAAAGGTGATGGCAGCCCAGAGGAGAGCTTGCTCACTGTCACCATCACAGAGACCACTGTCATTGAGTCGGATCTGGGTG

TGTGGAGTTCAAGGGCTCTCATCTACCTCACACTGTGGTTCTTCTTCAGCTTCTGTACACTGTTCCTCAACAAATACATCCTGTCCCTGTTAGAGGGAGA

GCCCAGCATGTTAG - UNI22338 - GTGCTGTGCAGATGCTGTCAACAACGTTAATTGGATGTGTTAAAATATTTGTTCCTTGCTGTTTATATCAAC

ACAAAACCCGGCTTTCTTACCCACCCAATTTCATCATGACTATGCTCTTTGTGGGCCTCATGAG GTTTGCAACGGTGGTTTTGGGGCTGGTCAGCCTCA

AGAATGTGGCAGTGTCCTTTGCTGAGACAGTGAAGAGCTCGGCTCCCATTTTCACGGTGATCATGTCTCGGATGATTCTGGGGGAGTACACAG GGCTGC

TGGTCAACCTGTCCCTCATTCCAGTCATGGGAGGACTAGCGTTGTGCACTGCCACGGAAATAAGCTTCAACATCCTGGGGTTTTCAGCTGCGTTATCCAC

CAACATTATGGATTG TTTGCAGAATGTTTTTTCAAAAAAGCTTCTCAGTGGGGACAAATACCGGTTCTC GGCCCCGGAACTGCAGTTCTACACCAGTG

CTGCTGCTGTGGCCTTGCTCATTCCAGCATGGACCTTCTTCATG GATATCCCTGTGATTGGAAGGAGTGGGAAGAGCTTCAGCTACAGCCAGGACATCG

TGCTGTTGCTGCTGACAGATGGCGCCTTGTTTCACCTTCAGAGTGTCACTGCATATGCCCTGATGGGAAAGATCTCCCCTGTGACGTTCAG TGTCGCCA

GTACTGTGAAGCACGCCTTGTCTATCTGGCTCAGCATCATCGTTTTTGGAAACAAAATCACTAGCCTGTCTGCCATTGGCACCATCCTTGTCACATTGGG

TGTCTTGCTCTACAACAAGGCCAGGCAGTATCAGCAGGAGACTATGCAGAGTCTGGTCACAGCCACCAGCCGAAACCCAGAAGATGACACAGAGCCCCTT

GTTCCCCAGGACTCTAGACAGCACCACTGATCACCTGATGCTGTGTAGATCCAGGCCTAGATGTTCCTTCTGTACTAGAGGGAAATGATGCAGGGCAGGT

CTCTCGCTCCTTCCTGGAAATCAGATGGGGAATTTGGGACTCAGCTTCTGCCTGGCAGAGCACCACAGGACCAAATGATCTACAGCTTCCCTGGCTGCAA

GTGAACCAGTGTCTCCGTGCCCAGCCTGCACTGTGGAATAAGCACAGGCTCCAGGATCAACCCGAGTTGCTGTCTGTTTGATGCCATCCAGGAGACCTAA

ACTTTTCTATCACCACCACCACCACCACCACCACCACCATGGAAGCCTCTTGGTTCTTGACAGTCTATGAAACAGACATTCCAGATGCCAATGACTCTAG

CATGGAGCCATAAAACCCAGAGTAGCAGGCAGAAGAGACAAGTTTCTCCTGCCACGGAGAGACAGTGCTGTGTGAAGGAGAAGTGTCTCCTCCTTGGCCT

GTGCTACATTGAACTACCCTGCTCCAGGGTTGTTGTCCCATGTTTCTGCTACCATTTTGTGATTGCCCATTCTGGGAAGTTGGCAGCAAATCTCTAATTC

Translation
 - UNI22338 - MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFS

FCTLFLNKYILSLLEGEPSMLG - UNI22338 - GAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMR RFATVVLGLVSLKNVAV

SFAETVKSSAPIFTVIMSRMILGEYTG GLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDC CLQNVFSKKLLSGDKYRFS SAPELQFYTS

AAAVALLIPAWTFFM DIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFS SVASTVKHALSIWLSIIVFGNKITSLSAIGTILV

TLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH

For any suggestions or comments, please send an email to unitrap@crg.es