Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042208 (0610010F05Rik)
Chromosomal location
Chr 11: 23473788 - 23533631 (-)
Description
RIKEN cDNA 0610010F05 gene Gene [Source:MGI Symbol;Acc:MGI:1918925]
RefSeq_dna
NM_027860 
RefSeq_peptide
NP_082136.2 
UniGene
Mm.413217 Mm.48031 Mm.415825 
MGI
MGI:1918925 
Uniprot/SWISSPROT
Q68FF0 
Human Ortholog
ENSG00000162929 (KIAA1841)
Omim not available
UniTrap UNI32835
Vector Insertion
Chr 11: 23531204 - 23533632
Public Clones IST14315G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32121
Vector Insertion
Chr 11: 23495380 - 23506767
Public Clones IST12255H1 (tigm) IST12255G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18368
Vector Insertion
Chr 11: 23476823 - 23481595
Public Clones not available
Private Clones OST424745 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109532
Sequence
AGGCGGGTGCGGCCGCGGCTCGTGAGGCCGCCTCAGCCTGGCGTGTGCGCCGGGTCGCGCCGTTCTGGGCGCGAGCGCGGGCGGTGCTGGCCGCTGCAGG

TGACACCGGCGCGGTGAGGGCCGCCGCGGCCCTGTGGAG - UNI32835 - ATGAGGAAACTGAGACACGGATTATCTGAATTAGACAATATCTTAAT

GGTAGAACCAAGATATAAAGTTGGACAGTTTGACTTCAGAATCTATACTTGTAACTCGTACATTGTACTGGGCCTTCAGTAAG - UNI32835 - CTC

TAAAAGATGAGTCGTGGATATCCAGAAAACAATAATTTTCTGAATAATAATAACCAAATGGTATTGGATATGATTCTTTATCCATTGATTGGAATCCCTC

AGACCATCAACTGGGAAACTGTGGCAAGGCTTGTGCCTGGATTAACGCCCAAAGAG TGTGTGAAAAGGTTTGATGAGCTAAAGAGCTGTGGAAGTTCAC

CTGTTGACAACCAGTATAACCCTTTAATGGCTACTGGAGAGGGTCCTGTTGAAACTTTAGCCACTTACATTAAATCTTCACTTCTGGACACACAAGGAGA

TTTTCAAGAGACTCCTGTTGATCAAGATACAGTTTCTAAAGCAG ACATAGTATAGCTACCACAAGGAATTGCTCTTCAGAAAGTGAAAACTGTACTGCT

CGTAATGCTGGAGAAGAGACTGGAGAATCTGAAGG GCCAAACATGGTGATCCATGTATGTGATGAAGCAAAAAGCTTGAAAGAAGATTTTATTTGCCCA

CGAGATCTTTTGATATCAGAAATGAAGTACTTTGCTGAATATTTATCCATGGATGCGCAGCGCTGGGAAGAAGTGGACATTTCAGTTCATTGCGATGTTC

ACATTTTCAACTGGCTGATAAAATATGTTAAACGGAACACTAAGGAGAGTAAAGATTGTGAGATTCCCGCTTTAG AGCCAGGGAATGTCATTTCAATCC

TTATTTCATCAGAGTTCTTGAAGATGGATTCACTA GTTGAACAATGTATTCAATATTGCCATAAAAATATGAATGCCATAGTAGCTGCTCCATGCAACA

TGAACTGTATCAATGCAAACCTTCTTACACGCATAGCTGATCTGTTCACACACAATGAAATTGATGACTTAAAAGACAAAAAAGATAAGTTTAGGAG TA

AACTGTTTTGTAAGAAGATTGAAAGACTCTTTGATCCTGAATACTCCAATCCAGATTCTAGAAACAATGCAGCAACACTCTATCG ATGCTGTTTGTGTA

AGAAACTTTTAACC
Translation
 - UNI32835 -  - UNI32835 - MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKE CVKRFDELKSCGSSPVDNQYN

PLMATGEGPVETLATYIKSSLLDTQGDFQETPVDQDTVSKAD DIV     
Transcript ENSMUST00000093267
Sequence
AAAAGATGAGTCGTGGATATCCAGAAAACAATAATTTTCTGAATAATAATAACCAAATGGTATTGGATATGATTCTTTATCCATTGATTGGAATCCCTCA

GACCATCAACTGGGAAACTGTGGCAAGGCTTGTGCCTGGATTAACGCCCAAAGAG TGTGTGAAAAGGTTTGATGAGCTAAAGAGCTGTGGAAGTTCACC

TGTTGACAACCAGTATAACCCTTTAATGGCTACTGGAGAGGGTCCTGTTGAAACTTTAGCCACTTACATTAAATCTTCACTTCTGGACACACAAGGAGAT

TTTCAAGAGACTCCTGTTGATCAAGATACAGTTTCTAAAGCAG GCCAAACATGGTGATCCATGTATGTGATGAAGCAAAAAGCTTGAAAGAAGATTTTA

TTTGCCCACGAGATCTTTTGATATCAGAAATGAAGTACTTTGCTGAATATTTATCCATGGATGCGCAGCGCTGGGAAGAAGTGGACATTTCAGTTCATTG

CGATGTTCACATTTTCAACTGGCTGATAAAATATGTTAAACGGAACACTAAGGAGAGTAAAGATTGTGAGATTCCCGCTTTAG AGCCAGGGAATGTCAT

TTCAATCCTTATTTCATCAGAGTTCTTGAAGATGGATTCACTA GTTGAACAATGTATTCAATATTGCCATAAAAATATGAATGCCATAGTAGCTGCTCC

ATGCAACATGAACTGTATCAATGCAAACCTTCTTACACGCATAGCTGATCTGTTCACACACAATGAAATTGATGACTTAAAAGACAAAAAAGATAAGTTT

AGGAG TAAACTGTTTTGTAAGAAGATTGAAAGACTCTTTGATCCTGAATACTCCAATCCAGATTCTAGAAACAATGCAGCAACACTCTATCG ATGCTG

TTTGTGTAAGAAACTTTTAACCAGAGAAACAGAAAGAAGAATTCCTTGCATCCCTGGAAAAATCAATGTGGACCGACATGGAAATATTATCTACATCCAC

ATAAG AGATAAAACCTGGGATGTACATGAATATTTGAATAGTCTTTTTGAAGAATTAAAATCTTGGAGAGATGTTTATTGGCGTTTGTGGGGCACAGTC

AACTGGCTGACTTGTTCAAGGTGTTACCAG - UNI32121 - GCTTTTCTCTGTATTGAGTTCTCACATTGTCAGTATCACTCAGAAGTGGTAGTTTA

TTCTAGCACAGTAAATTCACTAAACACTGTGGGCACTGGAATTTATCCCTGCTGTAACCAGAAGGTTCTTCGATTTGATCCTACTCAGCTCACAAAG - 

UNI32121 - GGCTGTAAGGTGAGGGACCACATGGTGGTTCTTCATGATCAAGGAGAAAATGATGATTCGCCTTCTTGCCCACCTGCTAAAATACTGGA

TGATCTGCACAAGCACAAAGACGTCATTGCTGTGCCTTTTTTAAAAGATGCAGTTAG - UNI32121 - TGATCCTGGGGTTGGCTCCTGTGATGAAA

AAGGCCTGGAATATGAAATTTTACTGGAACCAAATACACCGTGGGGCTCCAAAACTGGGGAGCTCAATGCT TTCTTGTCACTGAAAAACTGGACTCTGC

AGTTG AAACAACAGTCGCTGTTCTCAGAAGAGGAAGAGTATACCACGGGGTCTGAGGTCACTGAAGATGAAGTCGGTGATGAAGAAGAAATTGCCAAGA

AACAAA GGAAAAAGGAGAAGCCAAAGAAATTTACTAAGCCGCCAAAAAAACAACTGTCCTCACCCTGTTCTCAAAAGAAAGAGAAGACACTGGAGAAG 

TCAACTTCTAGAGATGTGTCTCCTTTTGT TGTGAGTATGCAGAAGAATAAATGGGATGCCTCAAGATCCTTGAGATTCAACCAAGATGCACAAAGAGAA

GATG ATCAGCGGCGGATGTCTGAAATTACAGGGCATCTAATAAAAATGAGATTGGGTGATCTGGACCGAGTCAAGGCAAAGGAATCAAAGGAA - UNI

18368 - TTTGCAGGAGGTATTTATTCTAGGCTTGAAGCACAAGTCAGAGCCTCAGTACCTGTCACTGCCCGGCAGAACAGCTCAGACAAAAACCAAAG

 GTCTAAAAGTCGTTTTGGTCAAGGGCGTCCTGCATAAAGCACCCTAAACATAAAAAGAGAGGAGGTACACTCTGGACATCTGAAATGCCCACTTCCTGA

AGATCTTCAGTGACTGATAGGTGCTCTATGAGTCATTCCTGCAGACCACATAAATCATGCTACAGTGACTGCTAGGTGTTCTATTAGTTATCCCTGCAAA

CCACAAAAATCATGCTTACACAAATATATAGTTAGGTTTTGTTAAAATCTTAACTATATATATGAATTTTTTATATAAATTTCTCTTTGTATAATTCTAG

GCTGTGTAGGAGATAATTGCAAACTTCACATAGTTAGGATTTCTAATATTTGTTGCCTTTTATTTATTTGACAAAGAAGAGGCCTAACTTGACAAGTAAC

TAAGTTGGTATGACCCTAAGAAATTAACAGAATGACTGGTAGTGTTACTATGCATGGGCACTGATCGTTGTATGTTTTGGGGCTGTTGAATCTTAGGCAT

AGCATTGAGAAATGAATTGTGTATGATGAACTGTCCAGTGATGTTAAATTTAGTTTGCATGGATATTAAGGAGTGACAGATCTCGAAGCTGTATTAATAG

AATTTCAAGGTGAGGTTATTTCAATACCATGCTGGTCAAGAAGGGTTGATCTTTTTCAGTAGTATTACGTGGGAGGTACAATGTTATTGAACTTCTGTTT

CTTTCAGTTTTTCATGCTTATCTGTAAATCATTTGAGCCTAAAATCCAATCCTTGCCTCGCTTCTGGATGAAGCTAGTGGCACTCTGAGTGGTGAGTCAT

TTCAGTTCTGTGGCACGGTCAGACCCATCCATTCTCTAAGTCTGCTTGAGCTCCCTCACAGCATGATTGCTAGGTACGAAGAGAGGTCTTAAAGTTCCCA

GGTAGAGGAGACGGCTGGGAACTTCAGATATTCACATAAAACTGTTTTATAGATCATGTTTTAATTTTTTTCTAACAAGGTAGATAGCATACTCAGGGAA

ATTTTGTTCCAGACTGTAAGCATGTACTAAGTTATGTGTTTGGAAATTGTTTATAGGTCTCTGAGAACCGTGAGATGCACACTGTTTCTATGTTTAGTTT

TTCTCTGCTTTGTGATTGATGTCTTCAAATTATTCAGATAATAAATCTTGATGATGTAAGGGAACAGCAATTGTAAAAGAAAAATTCATGTCTTACACCT

AGTTTACACAAAAAGAAATTATAATTTTTAGTATCTTTTAGTTGCTATATGAAGCTCTTAATTATTTGGTAATTATGCTTTTAATATCTATTTGGAAATT

TTATTCTGGTGTACAAATGCCTTTCAGTTATCTGATACTTTGGAAATAGCTTATATCATATTTATTTTCAAGAAAGTATTTCTTTGTATGTGATATGTAA

ATCCCACGAGTACCAGCCTTATAGTTGGCTCCTGGATTCTCTGATAGAAGGATTTGGATTTATATGTGTAAGCAATCTATGATCATTGTAATTAGAAGGG

AATATGCTCTTTTGATTTTCACAGATGGTAGAAGTGCTCATTGCTTCTCCCCAGAGGGGGCTGCTTTACTGATTGATGTTAACAGACTCGAGTAAAATCT

GATTCTCTACAGAATG
Translation
  MVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALE EPGNVISILISSEFLKMDS

L VEQCIQYCHKNMNAIVAAPCNMNCINANLLTRIADLFTHNEIDDLKDKKDKFRS SKLFCKKIERLFDPEYSNPDSRNNAATLYR RCCLCKKLLTRE

TERRIPCIPGKINVDRHGNIIYIHIR RDKTWDVHEYLNSLFEELKSWRDVYWRLWGTVNWLTCSRCYQ - UNI32121 - AFLCIEFSHCQYHSEVV

VYSSTVNSLNTVGTGIYPCCNQKVLRFDPTQLTK - UNI32121 - GCKVRDHMVVLHDQGENDDSPSCPPAKILDDLHKHKDVIAVPFLKDAVS - 

UNI32121 - SDPGVGSCDEKGLEYEILLEPNTPWGSKTGELNA FLSLKNWTLQL KQQSLFSEEEEYTTGSEVTEDEVGDEEEIAKKQR RKKEKPK

KFTKPPKKQLSSPCSQKKEKTLEK STSRDVSPFV VVSMQKNKWDASRSLRFNQDAQREDD DQRRMSEITGHLIKMRLGDLDRVKAKESKE - UNI1

8368 - FAGGIYSRLEAQVRASVPVTARQNSSDKNQR RSKSRFGQGRPA
Transcript ENSMUST00000043356
Sequence
AGCTCTAAAAGATGAGTCGTGGATATCCAGAAAACAATAATTTTCTGAATAATAATAACCAAATGGTATTGGATATGATTCTTTATCCATTGATTGGAAT

CCCTCAGACCATCAACTGGGAAACTGTGGCAAGGCTTGTGCCTGGATTAACGCCCAAAGAG TGTGTGAAAAGGTTTGATGAGCTAAAGAGCTGTGGAAG

TTCACCTGTTGACAACCAGTATAACCCTTTAATGGCTACTGGAGAGGGTCCTGTTGAAACTTTAGCCACTTACATTAAATCTTCACTTCTGGACACACAA

GGAGATTTTCAAGAGACTCCTGTTGATCAAGATACAGTTTCTAAAGCAG GAAGACATAGTATAGCTACCACAAGGAATTGCTCTTCAGAAAGTGAAAAC

TGTACTGCTCGTAATGCTGGAGAAGAGACTGGAGAATCTGAAGG GCCAAACATGGTGATCCATGTATGTGATGAAGCAAAAAGCTTGAAAGAAGATTTT

ATTTGCCCACGAGATCTTTTGATATCAGAAATGAAGTACTTTGCTGAATATTTATCCATGGATGCGCAGCGCTGGGAAGAAGTGGACATTTCAGTTCATT

GCGATGTTCACATTTTCAACTGGCTGATAAAATATGTTAAACGGAACACTAAGGAGAGTAAAGATTGTGAGATTCCCGCTTTAG AGCCAGGGAATGTCA

TTTCAATCCTTATTTCATCAGAGTTCTTGAAGATGGATTCACTA GTTGAACAATGTATTCAATATTGCCATAAAAATATGAATGCCATAGTAGCTGCTC

CATGCAACATGAACTGTATCAATGCAAACCTTCTTACACGCATAGCTGATCTGTTCACACACAATGAAATTGATGACTTAAAAGACAAAAAAGATAAGTT

TAGGAG TAAACTGTTTTGTAAGAAGATTGAAAGACTCTTTGATCCTGAATACTCCAATCCAGATTCTAGAAACAATGCAGCAACACTCTATCG ATGCT

GTTTGTGTAAGAAACTTTTAACCAGAGAAACAGAAAGAAGAATTCCTTGCATCCCTGGAAAAATCAATGTGGACCGACATGGAAATATTATCTACATCCA

CATAAG AGATAAAACCTGGGATGTACATGAATATTTGAATAGTCTTTTTGAAGAATTAAAATCTTGGAGAGATGTTTATTGGCGTTTGTGGGGCACAGT

CAACTGGCTGACTTGTTCAAGGTGTTACCAG - UNI32121 - GCTTTTCTCTGTATTGAGTTCTCACATTGTCAGTATCACTCAGAAGTGGTAGTTT

ATTCTAGCACAGTAAATTCACTAAACACTGTGGGCACTGGAATTTATCCCTGCTGTAACCAGAAGGTTCTTCGATTTGATCCTACTCAGCTCACAAAG -

 UNI32121 - GGCTGTAAGGTGAGGGACCACATGGTGGTTCTTCATGATCAAGGAGAAAATGATGATTCGCCTTCTTGCCCACCTGCTAAAATACTGG

ATGATCTGCACAAGCACAAAGACGTCATTGCTGTGCCTTTTTTAAAAGATGCAGTTAG - UNI32121 - TGATCCTGGGGTTGGCTCCTGTGATGAA

AAAGGCCTGGAATATGAAATTTTACTGGAACCAAATACACCGTGGGGCTCCAAAACTGGGGAGCTCAATGCT TTCTTGTCACTGAAAAACTGGACTCTG

CAGTTG AAACAACAGTCGCTGTTCTCAGAAGAGGAAGAGTATACCACGGGGTCTGAGGTCACTGAAGATGAAGTCGGTGATGAAGAAGAAATTGCCAAG

AAACAAA GGAAAAAGGAGAAGCCAAAGAAATTTACTAAGCCGCCAAAAAAACAACTGTCCTCACCCTGTTCTCAAAAGAAAGAGAAGACACTGGAGAAG

 TCAACTTCTAGAGATGTGTCTCCTTTTGT TGTGAGTATGCAGAAGAATAAATGGGATGCCTCAAGATCCTTGAGATTCAACCAAGATGCACAAAGAGA

AGATG ATCAGCGGCGGATGTCTGAAATTACAGGGCATCTAATAAAAATGAGATTGGGTGATCTGGACCGAGTCAAGGCAAAGGAATCAAAGGAA - UN

I18368 - TTTGCAGGAGGTATTTATTCTAGGCTTGAAGCACAAGTCAGAGCCTCAGTACCTGTCACTGCCCGGCAGAACAGCTCAGACAAAAACCAAA

G GTCTAAAAGTCGTTTTGGTCAAGGGCGTCCTGCATAAAGCACCCTAAACATAAAAAGAGAGGAGGTACACTCTGGACATCTGAAATGCCCACTTCCTG

AAGATCTTCAGTGACTGATAGGTGCTCTATGAGTCATTCCTGCAGACCACATAAATCATGCTACAGTGACTGCTAGGTGTTCTATTAGTTATCCCTGCAA

ACCACAAAAATCATGCTTACACAAATATATAGTTAGGTTTTGTTAAAATCTTAACTATATATATGAATTTTTTATATAAATTTCTCTTTGTATAATTCTA

GGCTGTGTAGGAGATAATTGCAAACTTCACATAGTTAGGATTTCTAATATTTGTTGCCTTTTATTTATTTGACAAAGAAGAGGCCTAACTTGACAAGTAA

CTAAGTTGGTATGACCCTAAGAAATTAACAGAATGACTGGTAGTGTTACTATGCATGGGCACTGATCGTTGTATGTTTTGGGGCTGTTGAATCTTAGGCA

TAGCATTGAGAAATGAATTGTGTATGATGAACTGTCCAGTGATGTTAAATTTAGTTTGCATGGATATTAAGGAGTGACAGATCTCGAAGCTGTATTAATA

GAATTTCAAGGTGAGGTTATTTCAATACCATGCTGGTCAAGAAGGGTTGATCTTTTTCAGTAGTATTACGTGGGAGGTACAATGTTATTGAACTTCTGTT

TCTTTCAGTTTTTCATGCTTATCTGTAAATCATTTGAGCCTAAAATCCAATCCTTGCCTCGCTTCTGGATGAAGCTAGTGGCACTCTGAGTGGTGAGTCA

TTTCAGTTCTGTGGCACGGTCAGACCCATCCATTCTCTAAGTCTGCTTGAGCTCCCTCACAGCATGATTGCTAGGTACGAAGAGAGGTCTTAAAGTTCCC

AGGTAGAGGAGACGGCTGGGAACTTCAGATATTCACATAAAACTGTTTTATAGATCATGTTTTAATTTTTTTCTAACAAGGTAGATAGCATACTCAGGGA

AATTTTGTTCCAGACTGTAAGCATGTACTAAGTTATGTGTTTGGAAATTGTTTATAGGTCTCTGAGAACCGTGAGATGCACACTGTTTCTATGTTTAGTT

TTTCTCTGCTTTGTGATTGATGTCTTCAAATTATTCAGATAATAAATCTTGATGATGTAAGGGAACAGCAATTGTAAAAGAAAAATTCATGTCTTACACC

TAGTTTACACAAAAAGAAATTATAATTTTTAGTATCTTTTAGTTGCTATATGAAGCTCTTAATTATTTGGTAATTATGCTTTTAATATCTATTTGGAAAT

TTTATTCTGGTGTACAAATGCCTTTCAGTTATCTGATACTTTGGAAATAGCTTATATCATATTTATTTTCAAGAAAGTATTTCTTTGTATGTGATATGTA

AATCCCACGAGTACCAGCCTTATAGTTGGCTCCTGGATTCTCTGATAGAAGGATTTGGATTTATATGTGTAAGCAATCTATGATCATTGTAATTAGAAGG

GAATATGCTCTTTTGATTTTCACAGATGGTAGAAGTGCTCATTGCTTCTCCCCAGAGGGGGCTGCTTTACTGATTGATGTTAACAGACTCGAGTAAAATC

TGATTCTCTACAGAATGTGCTTTGTATTTTATATCTGTCTGTGATACATGGACAGGCATTTCTTCTGCCAAGTACGTTAAGGTTTTCCTTACATTAATTC

TGAGCTCAAACTTATTGAAATAAATGGCAATG
Translation
MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKE CVKRFDELKSCGSSPVDNQYNPLMATGEGPVETLATYIKSSLLDTQGDF

QETPVDQDTVSKAG GRHSIATTRNCSSESENCTARNAGEETGESEG GPNMVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYLSMDAQRWEEVDISVH

CDVHIFNWLIKYVKRNTKESKDCEIPALE EPGNVISILISSEFLKMDSL VEQCIQYCHKNMNAIVAAPCNMNCINANLLTRIADLFTHNEIDDLKDKK

DKFRS SKLFCKKIERLFDPEYSNPDSRNNAATLYR RCCLCKKLLTRETERRIPCIPGKINVDRHGNIIYIHIR RDKTWDVHEYLNSLFEELKSWRDV

YWRLWGTVNWLTCSRCYQ - UNI32121 - AFLCIEFSHCQYHSEVVVYSSTVNSLNTVGTGIYPCCNQKVLRFDPTQLTK - UNI32121 - GCK

VRDHMVVLHDQGENDDSPSCPPAKILDDLHKHKDVIAVPFLKDAVS - UNI32121 - SDPGVGSCDEKGLEYEILLEPNTPWGSKTGELNA FLSLK

NWTLQL KQQSLFSEEEEYTTGSEVTEDEVGDEEEIAKKQR RKKEKPKKFTKPPKKQLSSPCSQKKEKTLEK STSRDVSPFV VVSMQKNKWDASRSL

RFNQDAQREDD DQRRMSEITGHLIKMRLGDLDRVKAKESKE - UNI18368 - FAGGIYSRLEAQVRASVPVTARQNSSDKNQR RSKSRFGQGRPA


For any suggestions or comments, please send an email to unitrap@crg.es