Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042210 (Abhd14a)
Chromosomal location
Chr 9: 106342385 - 106349958 (-)
Description
abhydrolase domain containing 14A Gene [Source:MGI Symbol;Acc:MGI:1915894]
RefSeq_dna
NM_145919 
RefSeq_peptide
NP_001103742.1 NP_001103741.1 NP_666031.2 
MGI
MGI:1915894 
Uniprot/SWISSPROT
Q922Q6 
Human Ortholog
ENSG00000042022 (ABHD14A)
Omim not available
UniTrap UNI16644
Vector Insertion
Chr 9: 106346638 - 106347856
Public Clones IST13607B11 (tigm)
Private Clones OST456403 (lexicon) OST431886 (lexicon) OST430047 (lexicon) OST425461 (lexicon)
OST415745 (lexicon) OST415241 (lexicon) OST402396 (lexicon) OST369030 (lexicon)
OST310652 (lexicon) OST302003 (lexicon) OST301366 (lexicon) OST295407 (lexicon)
OST267005 (lexicon) OST205946 (lexicon) OST68268 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18151
Vector Insertion
Chr 9: 106346276 - 106346420
Public Clones not available
Private Clones OST428994 (lexicon) OST288237 (lexicon) OST245532 (lexicon) OST189368 (lexicon)
OST187704 (lexicon) OST98379 (lexicon) OST68267 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25554
Vector Insertion
Chr 9: 106342951 - 106343137
Public Clones not available
Private Clones OST177108 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085117
Sequence
AGGGCAGAAGTCGTGTTTCTCCATGGAAAAGCATTTAATTCCCACACATGGGAACAGCTGGGGACGTTGCAGCTACTGTCAGAGAGGGGCTACCGGGCTG

TGGCCATCGACCTTCCAGGCGA TGGCAGGTCACGAGAAAGGACCACAATAAAAGCTT ATGGTTGTGAGCCACCAT - UNI25554 - TGGAGTTGC

TGGAGAGAGTGTTCCAGGACCTACAGGTGCAGAATACTGTGTTGGTGAGCCCCTCGCTGAGTGGCAGCTATGCCCTGCCCTTCTTGATGCAAAACCACCA

CCAGCTACGTGGATTCGTGCCCATCGCACCCACCTCCACCAGGAATTATGCACAGGAACAATTCGGGGCTGTGAAG - UNI25554 - ACCCCAACTC

TTATCCTGTATGGGGAACTGGACCACACCTTGGCTCGAGAGTCACTTCAGCAGCTCCGCCACCTGCCCAACCACTCTGTGGTGAAGCTGCATGATGCAGG

TCATGCCTGCTACCTCCACAAGCCAGAAGCCTTCCACCTCGCCCTTCTTGCCTTCCTTGACCATTTGCCTTGAGTGGACTCACCTCCCAGGATCGACCTC

GAAGAGTCTAGACCCTCTCTCTCTCCTCTTCCAGGGTGGCAGTCCCTGGCTGGGACTGGGGGACAGAGGATCAAGCCTAGCCAGGACCTTTGTATTTCAT

TTCACAAGCACAATAAAGAAAAGCCTTTTTGTCTTGCCTGG
Translation
RAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPGD DGRSRERTTIKAY YGCEPPL - UNI25554 - LELLERVFQDLQVQNTVLVSPSL

SGSYALPFLMQNHHQLRGFVPIAPTSTRNYAQEQFGAVK - UNI25554 - TPTLILYGELDHTLARESLQQLRHLPNHSVVKLHDAGHACYLHKPEA

FHLALLAFLDHLP
Transcript ENSMUST00000048685
Sequence
GGAGGCTGTACCACAGCCGCTAGGCTGTTTGGCAGTTGGTTCCGCCTAGGCCGGGCCCCGCCTCACCGGAGCCTTTCTGGTCACTCCTGTCCACGCG TC

TGCATCAGAACCCCTACAGTTGTCTAGTCTTGGGCACCCAAGTTGCCATGGCAACGAG GAGGAAGAGTGTGCTCTTTCTGCACCCGGCTCCTGATTTTC

TATCAGCACTGGAAGATCTGCTGAAGCCCACGCACAGCCTGACTTCGGAGCTAGGGAGTGAGGCCTGCAGAAGAGTTCCACAGAG - UNI16644 - G

TTCTATGGTACAGAAGAAATTCATGAGCCGGTACCAGGCAGCCCTGCTGGGTCTAGGCTTGCTGCTCGTGTTCCTCCTGTATATGGGCTTGCCTGGCCCA

CCCGAGCAGACTTCGCGACTCTGGAGAGGCCCTAATGTCACAGTCCTGACTGGTCTCACCAGAGGCAACTCTCGAATCTTTTACCGAGAGGTGCTGCCAA

TCCAGCAGGCACGCAG - UNI18151 - GGCAGAAGTCGTGTTTCTCCATGGAAAAGCATTTAATTCCCACACATGGGAACAGCTGGGGACGTTGCAG

CTACTGTCAGAGAGGGGCTACCGGGCTGTGGCCATCGACCTTCCAG GTTTTGGGAACTCAGCCCCTTCAGAGGAGGTGAGCACAGAGGCAGGCCGAGTG

GAGTTGCTGGAGAGAGTGTTCCAGGACCTACAGGTGCAGAATACTGTGTTGGTGAGCCCCTCGCTGAGTGGCAGCTATGCCCTGCCCTTCTTGATGCAAA

ACCACCACCAGCTACGTGGATTCGTGCCCATCGCACCCACCTCCACCAGGAATTATGCACAGGAACAATTCGGGGCTGTGAAG - UNI25554 - ACC

CCAACTCTTATCCTGTATGGGGAACTGGACCACACCTTGGCTCGAGAGTCACTTCAGCAGCTCCGCCACCTGCCCAACCACTCTGTGGTGAAGCTGCATG

ATGCAGGTCATGCCTGCTACCTCCACAAGCCAGAAGCCTTCCACCTCGCCCTTCTTGCCTTCCTTGACCATTTGCCTTGAGTGGACTCACCTCCCAGGAT

CGACCTCGAAGAGTCTAGACCCTCTCTCTCTCCTCTTCCAGGGTGGCAGTCCCTGGCTGGGACTGGGGGACAGAGGATCAAGCCTAGCCAGGACCTTTGT

ATTTCATTTCACAAGCACAATAAAGAAAAGCCTTTTTGTCTTGCCTGG
Translation
   - UNI16644 - MVQKKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVTVLTGLTRGNSRIFYREVLPIQQARR - UNI18151 -

 RAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPG GFGNSAPSEEVSTEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQLRG

FVPIAPTSTRNYAQEQFGAVK - UNI25554 - TPTLILYGELDHTLARESLQQLRHLPNHSVVKLHDAGHACYLHKPEAFHLALLAFLDHLP

For any suggestions or comments, please send an email to unitrap@crg.es