Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042249 (Adrbk2)
Chromosomal location
Chr 5: 113339498 - 113444534 (-)
Description
adrenergic receptor kinase, beta 2 Gene [Source:MGI Symbol;Acc:MGI:87941]
RefSeq_dna
NM_177078 
RefSeq_peptide
NP_796052.2 
UniGene
Mm.285619 Mm.396291 Mm.400992 
MGI
MGI:87941 
Uniprot/SWISSPROT
Q3UYH7 
Uniprot/SPTREMBL
Q8BVT9 
Human Ortholog
ENSG00000100077 (ADRBK2)
Omim not available
UniTrap UNI26986
Vector Insertion
Chr 5: 113384276 - 113386334
Public Clones not available
Private Clones OST80112 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065167
Sequence
GGCCCCGTCGGGGCGGCGGGAGCTGCGGAGCCGCCATGGCGGACCTGGAGGCCGTGCTGGCCGACGTCAGCTACCTGATGGCCATGGAGAAGAGCAAGAC

GGCGCCGGCCGCGCGCGCCAGCAAGAAGGTCGTCCTGCCGGAGCCCAG TATCCGGAGTGTGATGCAGAGGTATCTGGCAGAGAGAAACGAAATAACCTT

TGACAAGATTTTCAATCAGAAAATCG GCTTCCTACTATTTAAAGACTTCTGCTTGAATGAAATTGGGGAAGCAGTGCCTCAGGTGAAATTTTATGAAGA

G ATAAAAGAATATGAGAAGCTGGACAACGAAGAGGATAGGCTACGCCGGAGCCGGCAGATGTACGACGCCTACATCATGAGGGAGCTCCTATCCAGCAC

ACAC CAATTCTCAAAGCAAGCTGTAGAACATGTCCAGAGCCATCTCTCCAAGAAACAGGTGACGGCTACACTTTTCCAG CCATACATAGAAGAAATCT

GTGAAAGCCTTCGTGGGGATATTTTCCAAAAGTTTATGGAAAG CGATAAATTCACTAGATTCTGTCAGTGGAAGAACGTGGAGTTGAATATTCAC - U

NI26986 - CTGAGCATGAACGACTTCAGTGTGCACAGGATCATCGGCCGAGGAGGGTTTGGGGAAGTTTATGGCTGCAGGAAAGCAGACACCGGTAAA

AT GTATGCCATGAAGTGCTTAGACAAGAAAAGGGTGAAGATGAAGCAGGGGGAGACTCTGGCTTTGAACGAGAGGATCATGCTGTCTCTCGTTAGCACT

GGG GATTGTCCCTTTATTGTCTGCATGACCTACGCCTTCCACACGCCGGACAAACTCTGCTTCATCCTGGACCTGATGAACG GGGGCGACATGCACTA

CCATCTCTCTCAACACGGGGTGTTTTCTGAGAAGGAGATGCGGTTTTATGCCAGCGAGATCATCCTGGGCCTCGAGCACATGCACACCTGCTTCGTAGTC

TACAGAGACCTGAAG CCTGCGAACATCCTCCTAGATGAATATGGGCACGTGAGGATATCGGATCTCGGCCTTGCCTGCGATTTCTCCAAAAAGAAGCCT

CATGCCAGCGT GGGCACCCATGGGTACATGGCTCCCGAGGTGTTGCAGAAGGGAACGTGCTATGACAGCAGCGCCGACTGGTTCTCCCTGGGCTGTATG

CTCTTCAAGCTTCTGCGGGG CCACAGCCCCTTCAGGCAGCATAAAACCAAAGACAAGCATGAGATAGACCGAATGACCCTGACCGTG AACGTGCAGCT

TCCAGATGCCTTCTCCCCTGAGCTGAGGTCCCTCTTAGAGGGTTTGCTCCAGCGGGACGTGAGCCAGCGGCTGGGCTGCGGAGGAGGAGG GGCACGAGA

GTTGAAGGAGCACATCTTCTTCAAGGGCATTGACTGGCAGCATGTGTACTTACGGAAG TACCCGCCACCCCTAATCCCTCCTCGGGGAGAGGTCAACGC

TGCAGATGCCTTCGATATCGGCTCCTTCGATGAGGAAGACACCAAAGGCATTAAG CTGTTGGACTGTGACCAGGACCTCTATAAGAACTTCCCACTGGT

GATCTCCGAGCGCTGGCAGCAAGAAGTGGTGGAGACCATCTATGACGCCGTCAATGCTGATACTGATAAAATCGAGGCCAGGAGGAAGGCTAAAAATAAG

CAACTTGGTCAAGAGGAAG ATTACGCTATGGGGAAGGACTGCATCATGCACGGGTACATGCTGAAGCTGGGGAACCCCTTTCTCACACAGTGGCAAAGA

CGCTATTTTTACCTGTTCCCCAACAGACTGGAGTGGAGAGGAGAGGGCGAGTCTCGG CAAAGTCTACTGACCATGGAACAGATCATGTCTGTGGAGGAG

ACCCAGATTAAAGACAGAAAGTGCATCTTACTCAGGATAAAGGGAGGGAAGCAATTTGTCTTGCAATGTGAG AGTGACCCCGAGTTTGCACAGTGGCTG

AAGGAGCTGACCTGCACCTTCAATGAGGCCCAGAGACTGCTGCGCCGTGCCCCCAAATTCCTCAACAAACCACGGGCCGCCATCCTGGAGTTCTCCAAGC

CACCACTGTGTCACAGAAATAGCAGCGGCCTCTGAACCACAGAGCAGCGGGGCCTGAAGGAGGGGCCCCAGCTCTTCAGCCCAGGAGTGGAACGAAGCCA

CGGGGAACCGTGTGGGGCTAAGACACAGTGTTTCTGAGCACTGACGGGGCTGCTCCAAGCCGAGGAGGCTCAGGACACCAGGGCGGCCTTCTGGGAGCTG

GGACATCCTCGGGGCTGTCCTATCCACACTCGAAATTACTGAAGAAGCAGAGGCATTCTGCTGTGCAACTCTCTCACTTTGGTATCCAGGGACCCAGAAC

GTAAAATGGTCCTTACTTCTCAAGCTTTTATGTCTGGCAGGGAGCATATCTGGGGTGGAAGCACGGTCTCTGGGACTATGGTGGCCTGTTCTAGGCATTG

CTGTGTCCGAGTGCCTGCCTGAGGTGTAGGGGTTGAGGCTCCAGACACTGGAGGAGGGTCTCTGTAGGTCAGGGCTGACTCCTTGCTGTCCCTGAGGCGA

TGAGGTAACCCTGAGTATCGTGTGCACTTCCTTCCTCTGATGACTTCTTTCCAGGGATGCCCCTCGAGGAAACTTCGCGGCATCCATCACAGCCATTTCT

GGTGGGCACAGACTTCAAGCAGGACCTAGGTAACCCACCAGACAGTGCCCCCAATGCATGGCGTGCATAAACTTGGAGTCACCATCAATGGTTAGGTATG

ACAGAGTCCTCCTGATCCCCCAGTTTGACCTGGGGAGCATCTGAGGATGTGCCCAAGATAGACAAGAGTTGCTGCCTTGTCTTTCAGTATAGCTTATAAT

GATCTCACACTGGTGGGTGACAGTGTCCAGCGGTCGGTCCCCTATGCGCCCTGGCATGCCCCATACCCTCTGTCACTAATGCACTGTGCGCTGAGTTATT

CTGATGGGGGCAGCAGTTTGCCCAGCCCCCTTCCCCTTAAAAGTGGGTTTCTCTGCTGCTGCCTGGCCCCATGTCACACAATGAGAAGTCCTGCAAGGTC

TCGGTGGACTTGTCCAATTCCTGAGGCCTTGGGGGCGGGGGCAGTATGGTAGTGTTACTGGGTCTCTAGATGAAGTCCCGAGCACATAACCTGACAGCAG

AATTCTTTGTGTTCTGTCCTGGATCTTCCTGACAGTCCCCAGTGTGTATTATGTTCTTGTGCTGGGGAAAATGAGGTGTTTATTTATTGATATCTATGGG

GTTTTTTTTTTAATTGCAACTACCTTTTGAGAATTTGGAAGATAATTTACTGAGAGGGTCCATTACTCGGCAGGTGCATGAGGGACCTGTGAGACTCAGG

GCCTGTCTCACCGCACATGAATTCTGGGTTCATGATCACGCACAGGGCCGCTGTTCACTGCCTCCAGGGTGGGAATGTGGCGTCACCTGGCAGGGACACC

CTGCTTGCTTAAAAGACTAATATTCAGATTCTTCTACTTCTACTACTACTACTACTACTACTACTACTACTACTACTACTACTACTACTACACACACACA

CACTTAAGCGTTGTGGTTACTGTGTAGGCATGGTTAGTATGGACAGCTCACACATGCTCAGTCAGACCTGCAGGGAGGGGTAGGAGCTGTATCTCTGGTC

TCTTTAGCACATATAGAGACCTCCCCCCACCCCTTCCACATTGGGAGGGAACTTGACCCCAGCAGGTGCTGGGCTAGCTGTAACAGTCTCTTATCGGGGT

TATAGCTATACCAAAGTCTTTCAAGATGGCACAGGATCATGGGATCCTGCACCTGCACTAAATCACGCCAGACTGGCACAAATATCATGTGTTATTATTG

GCCAAGTTAATTTTAAGGCCCCTTTCCTTTTAGAAAAAGAAGTGTGTGTGGGTGTGTGTATGGTGGGGTCTCCTGCCCTCAACCCCATTTCCCTCGGGGA

CAGGAATGAGAGAGAGTGCAGATGGCCTCTGGCATAGTCCTAAAGATTCATATATGGGCTGGTGGTGGATCTGCTAGCGCCATCTCAAAGGCCATCTTTC

CACCCTGGCATGTGGCTAGGGTGTGTCCTGGATCCATAGGGTGGGAGGAGGAGCCAGATGGGTTTATGATACATGGCTGTTTGAGAGTTCCCATCATGCA

GGCAAGTCCCTAGATGCCTCTTGTACTCAGACTGTTAACAGGGCGAGTCATGAGTACTAGTGACCTGGGTTTCTGGCCTGGATCACTTATCATGATGGAG

GATGTTCCACTTATTGCTGTTTTTACACAGCTATACTCTACATAGGCGTGGTTTCATAAGGCAAGAATCAATGCACAAAGTCCAAGAATATCAGATAATT

TTAGAGCCACTATGTGACACACACCAAATTAAAACCTTTGGCAAGCCCCAGTTTGTTTATTATTTATTTTAATCTAAACTACCCTCTTGTCCTTAGGGCT

CCCTGCTTTTCCTCTGGGTCATAATTAAATGTGTGGGTTTTTTGTTTTTGTTTTTGTTTTTTGTTTTTGTTTTTAAACAAAGCCTGTGGAAATTGTCACA

CTGTAGTGGTTGACAGAGGAACCTGTCTTGCTACTGATACTCAAGTGTGCACATTGAAAGGCCCATTGGCTGACATTACAAACTGTCCATGTAAAACCAG

CAATGAAGGATGGATGGTGACCTACAGGGGAAAGACACTGCAGGTTCACAAGCCCAGCCTTGATTGGCAGAGGCAGGAGGCTTATGAGTTTGAGGCTAGC

CTGGCCTACATGGCAAGTCTCTGCCTCCAGAACACCAAGGGCTATGGCAGTAGCTCTGGGCCAAGGTCTTGCCTTACATCTCCAAGATTCTGGGTTTAAT

TCCCAGAGGGTGTGGACAGCGGGCAGCAGACTGTTAGCCAACTAATAAGATTTATCTCTAGTGGCCGCCTTGACCTTGGCTATGTGTCTGTGAGAAGCAG

CTGTTCTGAGGCCCCACTAGCCAGGATTGTTCACCAGTGGTCAGTGTGACAGAGAGGCAGAGCAACTCGGTACAGGAACTCACCGTTTCAGTGGTAGGGT

AAGGACAGAGGGAGAAGGCTTGGTTGGCTGATGGAAGCCACACACTTGGCATGATGACCCACCAAGGAGGGAATGAGGGGAGCTCAAGGGACACGCCCTC

AGAATCCCCCAAGGATTTTTGCAAGACTTGCTTCGTTCCTGAGGCCGAGTTGCCCCGTCATGAAGGTGCCGCCACGTGTTCTTCTATGGACATTCCCAGG

AAGGTCCCTCATCAGTGGTACATCCCCGGACACTGAGTCTGTCACCTGAGACTGTGGCTGTGTCGCCCAGGCAGTGTGAGGCTGTGACCTAGTCACTGTC

CATGAATGGGCTGTGGAGGGGTGCGTGTCCAACTTAGATGTGGTGAACCTCAGAATGGCATCACCGCCTTCCTACATGTTTGATTCCACTTCTACTTGGA

ACTTCCATAATTTAAATTTAAAAAAAAAAATCGTTTCTCTTCCTAAGTGAGGTTTACTCGAAAGTCTCAATTGCTCACATTCATGTTAATAGGACCTCTT

GCTTTAACTTCATTGGTTGGTTCAAGGCCTCTTTTCCTTTATTTGTTGCTATGGGAATGAAGAAGGATGAGCCCAAAGCCTCTTCTCCATTCTTGGTGGA

CATTAGCATTTTCTCTGTTGGTTGCTTTTGTCAACTTAGACAAATAAGAGAGAACGCAGCACAGCACCTCAGACTGGCAGCCCCAGGATTCAGGACACTG

AGACAGGAGAATGATAAGTCCTGGGACGTCCTGGGCTACAGCTACAGGGGAAACCCTGCCTTAGGAACAAATCAACTAACAGACGGAGTTGTTTCCTGAC

ACAGGTGTGAACACTCCTACAAGCCACCCGAAGGTGCCATGTTCCCAAAGTGGGAAACCACGCACTTTAAATGGCCTTCAATTGAAAAGCAGCCACAGAG

ACTTGGTTCGAAATGTTCGCCTTTCATGAAGGACAGAAGTCGTTACAGCTAATTCAAATCCATAGCGTAGAGTTAGGTCTCGGCTTCTAATAGTCTGAGT

CCTTCCAGGAAACAGAAACCTATGCCATCCCTTTTTATTTTGCCCTAAATGTAAAACATCTTTGACAGCAGCTTGGGAGTGGAGCCATCATTCTGATTAT

CAACTGTGATTTTTTTTTCCCTCCATTTCCTTGGATTTTTCACCTGCCCTGTGGTTATATGTATTGTATGTGGTTTATAAATTCAACACTGGCTTTTTTT

TAGTTCTGTTATTAAATTATATTTTTCTATGTTCTAAGTAATAGCAGATCTGGCTTCTTCTGGTAACAGAGATGGATGGACCTGTAACTAGGAGACAAGA

GTTCTATTTTAGCACAAAAGCATTTTATATTATTTATTGAATCCGTATGTGCGTTCCCATGGAAACCATCTGTATTTCTGCTTCTTGTGATCTGTATAGT

TTGTTATTTAAAGAGAGATGGCAGCCTTTTGTGTTGCTGAAACAATAAAACCAAGCTCCTACAAGCAGTG
Translation
MADLEAVLADVSYLMAMEKSKTAPAARASKKVVLPEPS SIRSVMQRYLAERNEITFDKIFNQKIG GFLLFKDFCLNEIGEAVPQVKFYEE IKEYEKL

DNEEDRLRRSRQMYDAYIMRELLSSTH QFSKQAVEHVQSHLSKKQVTATLFQ PYIEEICESLRGDIFQKFMES SDKFTRFCQWKNVELNIH - UNI

26986 - LSMNDFSVHRIIGRGGFGEVYGCRKADTGKM MYAMKCLDKKRVKMKQGETLALNERIMLSLVSTG DCPFIVCMTYAFHTPDKLCFILDLM

NG GGDMHYHLSQHGVFSEKEMRFYASEIILGLEHMHTCFVVYRDLK PANILLDEYGHVRISDLGLACDFSKKKPHASV VGTHGYMAPEVLQKGTCYD

SSADWFSLGCMLFKLLRG GHSPFRQHKTKDKHEIDRMTLTV NVQLPDAFSPELRSLLEGLLQRDVSQRLGCGGGG GARELKEHIFFKGIDWQHVYLR

K YPPPLIPPRGEVNAADAFDIGSFDEEDTKGIK LLDCDQDLYKNFPLVISERWQQEVVETIYDAVNADTDKIEARRKAKNKQLGQEED DYAMGKDCI

MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESR QSLLTMEQIMSVEETQIKDRKCILLRIKGGKQFVLQCE SDPEFAQWLKELTCTFNEAQRLL

RRAPKFLNKPRAAILEFSKPPLCHRNSSGL

For any suggestions or comments, please send an email to unitrap@crg.es