Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042272 (Sestd1)
Chromosomal location
Chr 2: 77018397 - 77129163 (-)
Description
SEC14 and spectrin domains 1 Gene [Source:MGI (curated);Acc:Sestd1-002]
RefSeq_dna
NM_175465 
RefSeq_peptide
NP_780674.1 
UniGene
Mm.458638 Mm.27120 Mm.389296 Mm.402555 
MGI
MGI:1916262 
Uniprot/SWISSPROT
Q80UK0 
Human Ortholog
ENSG00000187231 (SESTD1)
Omim not available
UniTrap UNI22378
Vector Insertion
Chr 2: 77103826 - 77118611
Public Clones IST14125H8 (tigm) IST14121H8 (tigm) IST13224H9 (tigm) IST10856B10 (tigm)
Private Clones OST298987 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000044107
Sequence
CGACCCCAGCCCGGCCCGCCGCAGC - UNI22378 - CAGAGGCAAGGACGTGAAATGGAGGCCTCGGTGATATTGCCCATTCTGAAGAAGAAGCTGG

CCTTCCTTTCAG GAGGAAAGGACAGACGCAGTGGACTCATCTTGACAATTCCGCTGTGCCTTGAGCAGACAAGTATGGATGAGCTGAGTGTCACTTTGG

ATTATCTACTCAGCATTCCAAG TGAGAAATGTAAGGCCAGAGGATTCACTGTGATCGTGGATGGCAGGAAGTCTCAGTGGAATGTGGTGAAGACAGTTG

TCTTAATGCTGCAG AATGTTGTTCCAGCCGAGGTATCCCTTGTTTGTGTAGTGAAGCCAGATGAATTCTGGGATAAGAAAGTAACACACTTTTGTTTTT

GGAAAGAAAAGGACAGACTTGGCTTTGAG GTTATTTTAGTGTCCGCCAATAAGTTGACGCGTTACATAGAGCCATGCCAGTTGACAGAAGACTTTGGTG

GGAGTCTCACCTATGACCACATGGACTGGCTGAATAAGAGGCTG GTCTTTGAGAAGTTTACAAAGGAGTCTACATCATTGCTAGATGAACTTGCTCTGA

TTAACAATGGAAGTGATAAGGGGAATGAGCAGGAGAAAGAAAG GTCTGTGGATTTAAACTTTCTTCCATCCGTTGATCCTGAGACGGTTCTTCAGACAG

 GGCATGAGTTGTTATCTGAATTACAGCAGCGTCGATTTAATGGCTCCGACGGAGGGGTCTCGTGGTCTCCTATGGATGACGAGCTGCTGGCACAGCCGC

AGGTTATGAAGTTGCTGGACTCACTCCGGGAGCAGTACACGCGCTACCAGGAAGTCTGCAGGCAGCGCAGTAAGCGCACACAGCTGGAGGAGATCCAGCA

GAAGGTGATGCAG GTTGTGAACTGGCTTGAAGGGCCTGGATCTGAGCAACTGAGAGCACAGTGGGGCATTGGTGACTCGATCAGGGCCTCCCAGGCCCT

GCAACAGAAGCATGAGGAGATCGAGAGCCAACACAGC GAGTGGTTCGCAGTATACGTGGAGCTTAACCAGCAGATTGCAGCACTCTTAAACGCTGGAGA

CGAGGAAGATCTTGTGGAGTTGAAGTCTCTACAGCAACAGCTTAGCGACGTTTGCTATCGACAGGCCAGTCAGCTAGAATTTAGGCAAAACCTCCTGCAG

GCAGCTTTGGAATTTCATGGTGTGGCCCAAGAT TTGTCTCAGCAGTTGGACGGCTTATTAGGGATGTTGTGCGTAGATGTAGCACCAGCTGATGGAGCA

TCGATTCAGCAAACTTTAAAACTGCTTGAAGAGAAGCTGAAAAGTGTTG ATGTAGGATTGCAAGGCTTGCGAGAAAAAGGTCAAGGTCTCCTGGATCAG

ATCTCCAACCAGGCTTCCTGGGCCTATGGCAAGGATGTAACTATTGAAAATAAAGAAAACGTGGACCACATACAAGGAGTGATGGAAGACATGCAACTTA

GGAAACAAAG ATGTGAGGACATGGTAGATGTGCGGAGGCTGAAGATGCTTCAGATGGTGCAGTTGTTTAAGTGTGAAGAGGATGCTTCACAG GCAGTA

GAATGGCTGAGTGAACTTCTGGATGCCCTGCTGAAGACCCATATCAGGCTGGGTGACGATGCTCAGGAAACAAAGGTTTTACTGGAAAAACACAGAAAAT

TTGTCGATGTTGCCCAG AGTACTTACGACTATGGCAGACAGCTGCTGCAGGCCACAGTTGTACTGTGCCAGTCTCTGCGCTGCACTTCCCGGTCCTCAG

GGGACACACTTCCTCGACTGAACAGAGTGTGGAAGCAGTTTACAGTCGCATCTGAAGAGAGAGTGCACAGGTTGGAGATGGCTATTGCCTTTCACTCCAA

TGCCGAAAAG ATTTTGCAAGACTGCCCAGAAGAGCCTGAAGCAATGAATGATGAGGAACAGTTTGAGGAAATTGAAGCAATTGGAAAATCACTTCTGGA

TAGACTCACTATCCCCGTGGTTTACCCCGACGG AACTGAACAATATTTTGGAAGTCCAAGTGACATGGCTTCTACTGCAGAGCACATCAGGGACAGAAT

GAAACTGGTCAGTCTCAAAAGGCAGCAGCTGAGACATCCCGAATTGGTGACCACGGAGAGCTAATGTCCCCAGCTCCCGCAGATCTGCAGGTCATACGCC

CACATTCTTTGCTGCTGGCATTCTCTGGGGTTAGCCACAGCTCGTTAAGATGCATTTCACAGCGGGATAAGCCTCCTTTCTTCCCACGACACGTGTCTCT

CTCTAAATGCTAACATTTCTCCACCACCAAGGCATAGTCACAACATGCTTTGAGACTGTAGACTCCTGGTATCCTAAGAGAAGGAATTGTAACCACCGCA

CTGAGTCCTCGCTTTCACGCCGTACCTGACTTGTCAGTTTGTAGCCAAACAACCAATACTAAGCTTTGAATGGTGCTAATCAGAGTTTAGGAATTCTCTA

TAAAACATGGCTGCCCTTCCTCCCCAGGTGATGTAGGATATTTAGACCATAGTTAGACTGTTAGTGAATAGTGGTGTCCTCAAAATTTTACTTTGTAATT

CTTCAAAATTGATTATTTTTAATGTCTATATGAAGAAAACCCTTCAGATCTTTGATATATCATATTCATTGAAAGACATTTTCCTATTGTATTCATAATG

TATTAAAAGTTGTTTGTGCTTAATAAAAATCTTCTTTAAA
Translation
 - UNI22378 - MEASVILPILKKKLAFLSG GGKDRRSGLILTIPLCLEQTSMDELSVTLDYLLSIPS SEKCKARGFTVIVDGRKSQWNVVKTVVL

MLQ NVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFE VILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRL VFEKFTKESTSLLDELAL

INNGSDKGNEQEKER RSVDLNFLPSVDPETVLQTG GHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLE

EIQQKVMQ VVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHS EWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFR

QNLLQAALEFHGVAQD LSQQLDGLLGMLCVDVAPADGASIQQTLKLLEEKLKSVD DVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQG

VMEDMQLRKQR RCEDMVDVRRLKMLQMVQLFKCEEDASQ AVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQ STYDYGRQLLQATVVLC

QSLRCTSRSSGDTLPRLNRVWKQFTVASEERVHRLEMAIAFHSNAEK ILQDCPEEPEAMNDEEQFEEIEAIGKSLLDRLTIPVVYPDG GTEQYFGSPS

DMASTAEHIRDRMKLVSLKRQQLRHPELVTTES
Transcript ENSMUST00000102660
Sequence
CAGCGTTTGAAAAATATTGTGCTGCCTCCTTCTGCCTACTGTGGTGTCTGAGGAGAGGCCTGCTGTCTTTTGAATTGTTTGTCAGAACACCGG AGGCAA

GGACGTGAAATGGAGGCCTCGGTGATATTGCCCATTCTGAAGAAGAAGCTGGCCTTCCTTTCAG GAGGAAAGGACAGACGCAGTGGACTCATCTTGACA

ATTCCGCTGTGCCTTGAGCAGACAAGTATGGATGAGCTGAGTGTCACTTTGGATTATCTACTCAGCATTCCAAG TGAGAAATGTAAGGCCAGAGGATTC

ACTGTGATCGTGGATGGCAGGAAGTCTCAGTGGAATGTGGTGAAGACAGTTGTCTTAATGCTGCAG AATGTTGTTCCAGCCGAGGTATCCCTTGTTTGT

GTAGTGAAGCCAGATGAATTCTGGGATAAGAAAGTAACACACTTTTGTTTTTGGAAAGAAAAGGACAGACTTGGCTTTGAG GTTATTTTAGTGTCCGCC

AATAAGTTGACGCGTTACATAGAGCCATGCCAGTTGACAGAAGACTTTGGTGGGAGTCTCACCTATGACCACATGGACTGGCTGAATAAGAGGCTG GTC

TTTGAGAAGTTTACAAAGGAGTCTACATCATTGCTAGATGAACTTGCTCTGATTAACAATGGAAGTGATAAGGGGAATGAGCAGGAGAAAGAAAG GTCT

GTGGATTTAAACTTTCTTCCATCCGTTGATCCTGAGACGGTTCTTCAGACAG GGCATGAGTTGTTATCTGAATTACAGCAGCGTCGATTTAATGGCTCC

GACGGAGGGGTCTCGTGGTCTCCTATGGATGACGAGCTGCTGGCACAGCCGCAGGTTATGAAGTTGCTGGACTCACTCCGGGAGCAGTACACGCGCTACC

AGGAAGTCTGCAGGCAGCGCAGTAAGCGCACACAGCTGGAGGAGATCCAGCAGAAGGTGATGCAG GTTGTGAACTGGCTTGAAGGGCCTGGATCTGAGC

AACTGAGAGCACAGTGGGGCATTGGTGACTCGATCAGGGCCTCCCAGGCCCTGCAACAGAAGCATGAGGAGATCGAGAGCCAACACAGC GAGTGGTTCG

CAGTATACGTGGAGCTTAACCAGCAGATTGCAGCACTCTTAAACGCTGGAGACGAGGAAGATCTTGTGGAGTTGAAGTCTCTACAGCAACAGCTTAGCGA

CGTTTGCTATCGACAGGCCAGTCAGCTAGAATTTAGGCAAAACCTCCTGCAGGCAGCTTTGGAATTTCATGGTGTGGCCCAAGAT TTGTCTCAGCAGTT

GGACGGCTTATTAGGGATGTTGTGCGTAGATGTAGCACCAGCTGATGGAGCATCGATTCAGCAAACTTTAAAACTGCTTGAAGAGAAGCTGAAAAGTGTT

G ATGTAGGATTGCAAGGCTTGCGAGAAAAAGGTCAAGGTCTCCTGGATCAGATCTCCAACCAGGCTTCCTGGGCCTATGGCAAGGATGTAACTATTGAA

AATAAAGAAAACGTGGACCACATACAAGGAGTGATGGAAGACATGCAACTTAGGAAACAAAG ATGTGAGGACATGGTAGATGTGCGGAGGCTGAAGATG

CTTCAGATGGTGCAGTTGTTTAAGTGTGAAGAGGATGCTTCACAG GCAGTAGAATGGCTGAGTGAACTTCTGGATGCCCTGCTGAAGACCCATATCAGG

CTGGGTGACGATGCTCAGGAAACAAAGGTTTTACTGGAAAAACACAGAAAATTTGTCGATGTTGCCCAG AGTACTTACGACTATGGCAGACAGCTGCTG

CAGGCCACAGTTGTACTGTGCCAGTCTCTGCGCTGCACTTCCCGGTCCTCAGGGGACACACTTCCTCGACTGAACAGAGTGTGGAAGCAGTTTACAGTCG

CATCTGAAGAGAGAGTGCACAGGTTGGAGATGGCTATTGCCTTTCACTCCAATGCCGAAAAG ATTTTGCAAGACTGCCCAGAAGAGCCTGAAGCAATGA

ATGATGAGGAACAGTTTGAGGAAATTGAAGCAATTGGAAAATCACTTCTGGATAGACTCACTATCCCCGTGGTTTACCCCGACGG AACTGAACAATATT

TTGGAAGTCCAAGTGACATGGCTTCTACTGCAGAGCACATCAGGGACAGAATGAAACTGGTCAGTCTCAAAAGGCAGCAGCTGAGACATCCCGAATTGGT

GACCACGGAGAGCTAATGTCCCCAGCTCCCGCAGATCTGCAGGTCATACGCCCACATTCTTTGCTGCTGGCATTCTCTGGGGTTAGCCACAGCTCGTTAA

GATGCATTTCACAGCGGGATAAGCCTCCTTTCTTCCCACGACACGTGTCTCTCTCTAAATGCTAACATTTCTCCACCACCAAGGCATAGTCACAACATGC

TTTGAGACTGTAGACTCCTGGTATCCTAAGAGAAGGAATTGTAACCACCGCACTGAGTCCTCGCTTTCACGCCGTACCTGACTTGTCAGTTTGTAGCCAA

ACAACCAATACTAAGCTTTGAATGGTGCTAATCAGAGTTTAGGAATTCTCTATAAAACATGGCTGCCCTTCCTCCCCAGGTGATGTAGGATATTTAGACC

ATAGTTAGACTGTTAGTGAATAGTGGTGTCCTCAAAATTTTACTTTGTAATTCTTCAAAATTGATTATTTTTAATGTCTATATGAAGAAAACCCTTCAGA

TCTTTGATATATCATATTCATTGAAAGACATTTTCCTATTGTATTCATAATGTATTAAAAGTTGTTTGTGCTTAATAAAAATCTTCTTTAAACATCTTAT

TTAATTTGGTAGTTACGTCCTGCTTCTAAACACGAGTGCCTTACTAACGGGGCATTCTTAGAATTGTAAGGAGGGTTAATCATTGTTTGTGATGGTGGAT

GCATGTATTTTAGGCAAGAATTTCATATGTATGCATGTGTATATAATAAAAAACAAGCATGTTTATTGTGAAGAATAATTTAGACCATTAAGAACATAAT

AATAGAATACTATTTTAAACTTTTCTCTTGAAAAATGGTGTCCAGAATATTAGCTCCCCTGAAGACACTTTGTCTGTGGGGAAGGAGGGCTAAAGATGAA

GGTATACATACTCAATGTAATCTTTTATATCACAGCAATCACTCTGGAACTAAAGCAGAAATTGTTAATAATATTTAATATCTCATGGTATTAGAGGCAA

AAAAATCATCCTGAAGTATAGTCACAAAAACTGTATAGATCTTTAGAAATAAAATTTGTCATAAAATGGTAATGCTTTTATGTTTGTATTAAGTTATAAA

ATGTATATACTTTAACATTGTGTTAATTTTAATTTTAGAATATATTTTAAGGTGAAAATAACTGGGCTTATCAGTACAAAATTATGCAAAGAATCGTATG

CAGGTTTATTTTTCTGGTCTGTAAAGACGATCACGTACCTTCCTATGTTCAAGCCAGTTTCTCCAGCCTTCTTTTTTGCCAGCCTTGATGAATTTCATCA

TCCTCACCCTCACCCTGTGTCACCTTTCAGTCAGCTTTGCGCCTCACTTTACAGGAAACGGCCATAGTCTTCTGGGTCCCGCATTGAATGTTTTTGCTCT

CTGACACGTCACCTTCCTTTCGCTCCGTTTCTAGTCTCTCCCTAACAGTGCTCCATCCCTCAGTGGTGCTCTCTCCTGCCATGTGAGGGCATGGTTTAGG

TCTGTTGCACATGCACACTGTGCTGCTGTCCTCAGCTCTTGCTCATTGGGCATCCCATCCCTAGTCCTGCATTTCACGTCCGATCCCAATTGCATAGCTT

TCAGCTGACTCGGTCCTCTCCCCTAAATGAAAGCATATCCTACTTGCCTTTTCTTCCTGAGTAGTTTTGATTAATGGTGCCAACAATGTCCAGGGCAAAC

CTCAGCTGTTCCCCATGTCTTACTCTGCCTCTGAGACCATCCAGAAGTCTTTTCTATACTTGATAACCCTTCTTCAGGGCTCGCCTCCTGTGCATAGGAG

CTCCTGTGATTCTTTCTTCAGTCTTCATGATGGTGCTAACTTTTCCTGTTACATCATAAAGTCCTCTTGGGGGTGACTCTTGTCCCACATGTCTTGTGCC

TAGACCTTTGCTCATGTGTGACATGCTCAGTCCTACAGCTGTGTTCCTTTGTCAGCGTTAGTAATAATCTCTCCACTACTGCAGTCTGAGGTCTATTTAA

ACAGTGTTTGGCTTTTCCTAGCGTTAGAACTGACTTGTAAATCTGTGTCCATGGAATGTGTCTGATGTTTTAGATCCTTAGATGTGGAACTTTTAGATAT

TGTTTATATTCAGTATCAGTCTCTTTTTACTGAGTTTCAGCATCATCAGTATCTTTATTTGACTTGGTAATTATGCCATCAGCTCATGGATGCATAATTT

CAATTTAATTTTCATATATCTTAAGCCCTCTTCCCTGCAAAAAGTGGAATAAGACAAACCATGGAAATGCCATGTCGGACTTGAAAGTTAAATGGAACGA

GATACACAGAATGGACATAGTCGCTCTTCTTTGGCAAATGTGGACCCCTTTTCCATGGGTTTATCTTTATAGATACACAAGAGTTATGAATAAAAACCGA

GCAATGCCCAAACTGACTTTCCTCATGTGGTCACAGTTCACTTAGAGGACATATGAAGGAGGTGACTTCGGTTTGTGTGAAATCTCAGGCCTTTGTTATA

TTAATACTGACATTGACCTAAAAATGTCATTAAAAAGAAATACTTCCTTCTTACTGGTTCAATGCCGCAGCCCCCTGCATTATTTTAACCCTTCTGGAGG

TTGACTGACACATTAGCTAGCTAACTTTTGTGTCTGGCTTTTTTTTTTTTTTTCTTTTTTGCCCGTGCCTATCTTTGTTCCTGTGTAAACTCAGCAGACA

ATGGCAATTTGATGTCTTCTCTTAGTACGTATCTGACTCGGCAGAGCTGTGATGCAAAGACGATAACTTCCTTTGAGACCAGTTTGGCTGCATTCCCAGT

TCTCATCGTTCTGACCTTATTTTACAGGGGAGTCATTAGTGATCTTGGTGAGAGCTCATCCTGTTAGCTTCCATTCAGTACAGGAGAGTGGGCTGGATCT

CGTACTTCATTGGGATTGAAAGTGGCTTGTGGATGTTATCTACTCGGAATGTGTCCGTCACTGCAGTATTCTCAGTTGATAGGTGGTATGATGTCAGTAT

TGTGACCCATTCTCAGTGAGAACATGACAGGTTGCTAAGCAAATCTTATTTTCTCTTCTAAACCCCTTTGCATGCTGTGGTATGATTGCAAGGTTGGGTG

AATGCATCCCACCGCACAGGATACTTTGGTAGAGACCATCAGCCTTCTTTTATATGCTAGAAGTACTTGTCAGAAGAGATTGTGTGTTCTTACACATGTC

TCCCATCCTACCCAAAGCACACTGAGTCATAATAAAAGCAGGATGGCTGCTAAGAACTAAAGATACAGTAGCTGATGCAATGCTGTAGCTCTTGAGTTGT

AGAGAAAGTATAGGCTAAAATAAACATCCATAAATAGTCTGCTATCCACAGCAAGACTTGTGCGATGGTGCTCTGATTATACATCCAAAAGAAAAGCTCT

CCAGAGTTAAAAAAGATGGTATGAAGAAAGCCAAACAGCACCAGTGTTAACTTTCAATGCTAGACATAAACATTGTTGCTTGAGAGCAGAAAGCCTTTTC

TTATATGTAGCCAGTAAATGTCTTGGTGGAACAAAAGTGAATACCATTTGACACTCCTTGATTTCTCAGAGTCACTTTATGTCAGTGAATATCCTGAGAC

TCTAAAATATGAAATGCACAAGTCATCAATTTCAATAACAAAATGTAATAATTTACAGAAGTATTGAAAACTAAAGGGGCATAGTATCATTGCTATAATC

TTTTTCAGAGTAGAAAGTAGTGTTCTTTAATCTTGCTCTGTCTCAAGTGACATTCATGGAGTGGAAGAGAGGACACGCTGTTTGTTTATCCCCTCTGCTC

CATACACCTTCTTCACCCCTACCCCTTATCCTTACCCCTACTCCTTTTACCCCTACCCCTTCATCCCTGCACTCTTCACCTCTGCCCGCATCTCACCAGT

GGATAAGGGAATGCGAATTCAGATCACATCCCGAGGGTGGAGCTGGTGCCCTCATCAGTGAATGAAGCTTTAACGCTGGCACACTCCCTGCTGTGGGAAG

ATGATGGAACAGTAAGATAGGAGACAAGACACAAATAGCATCTGTGTTGGGTTTGACAGGGCATGAGTCGACTCCATTTACTCCACTAGTTAGCAAGCCA

AAGAAAGGCATGGTTGGAGTGTAGCAAGAAAGGAACAAGCTATAGAACAAGAGCATACATCTGAGGATATTTGTAGGATCTCCCAATACCGAGGTAGACA

TGACTTGAGACAACCATTAGTGCTGGCTTTGGTTAGAAAAGAGGCAGTCTGACAAACTCAGGCAGTGATGGTGCTGGGGAAAGGTCCTGTAATAGAGCTT

AGACGTGGCAGCACTGGTCTGTGTTGGTGATGTTCAGTATGACTTAATGCTGCAGGGGTAGTTAAAGGCTAATGAGAATAAACACCAGTCTGTACACTTC

AGGAAGAGGCAGAGCCTGTGCTAGGACATGGAGATCTTCAAGAGAACAAGAGAGCCAGCACTGAGACTAAATATTTTTGAATGCTGGTGAATAAATGTTT

CATAGACACAAAATTATTTTTCTGAGAACTCCTAATGAGACAAGCTGCAATATATAATTCTTCTATGTCATGATACAGGAATTCCAAACATGGCTAAAAA

TAGTTACTGTCAAGTATTAAGAGCAGAGTTGTGAGGGTTTGAAGGGAGACGTGTGGAACAGCGTGTCTGACAGGGCTTTGCACTCTGGTTCCTACTGAAT

CTTGAGGGGACATCTTAACAAGTGTTTACAAGTCCAATGCAGAACCCTCACAGTGACTGCATAGATCTCCCTGTAGAGGTTGAAGACAATGCCTGTCCAC

TGAAGGCTACAAGATCACATCTTTCATGTCTTATTTTCCTGGCTGTTTTAGCTTGTGAGACAGAGCACTAAACCATTCTTAGGGTTGCTTTCTCTGCAGA

AAGTGCCTGCATCTGAGCTCAGGTGTTAGTCTTCACAGCCAGTGAAGTTGCTCAGGGAACTGCATCAGGGTAGGTGTAGTTCTGAGAGTTGTGAGAGGAT

CCAAAGATCACTTGGGCAGGTTTGAGTAGATTTGGGAGCTGCATTGCTCTCTTCAGACTCGGAAGAAAAACTTAATTTTCTAAATTGGCACATAGAAGTA

TTTGGTCATTATCATGTTGAAAGAGAATTTGGGGTGGGGGTGGGGAGTAAATGTCGAAATTTCTGTTTCCTGAAGTCTTAATATAAAAATTTTCAGTCTA

TAAAATTTAAGATTATTTCATCACGTCCTTACCACCATTAGTTACCCTTGCTTTGTCACTTGCCCGACCGTCTGTATGTCCATCCATCCAGATTATTTTT

CAGTGGATCTGAAGCTGCAGATCTCTGCATGCTTCCATCTAAACACTTTAGCATATTTCTCACCAGTAAGGGTTCCATATTTGCTTTCTCTTGGCATAAG

ATTACATTCATGGAGTGAAGATGCACAGAACCTTTCCATGCTCTGTTTCATAGTTATGTGGCGTGCTATAGAAAAGGACATCTACCACTCTAGAAAGTTC

TCCCCTCTCACTCATCACTGTCCCCAAATGACAAGCCCTGTTCTTCCTTTCTATTGTGAGTTAGATTGTTCTATTTCAGAACTTATTTTAATTCATATCA

CACATCAAGGCTTCTTTACTGCCATGGTATTTGGGAGGTTTATTTGTGGACTTGGTGTATTATTAATTCATCCTTATGTTATTACTAAGTGGTGTCCCCA

TGATTGGATATTGCCACTTGTTTTCTCAGTTTCCTATTGGCTAACTGGGCTGTTTGCAGGACTGTCAACTATGAACAAAGCTGCAGTGGTCATTATTAGG

AGCATACATATGAATATAGTTATTCACGTGCTCGTGAGTAAATACTTAGAATTGCTGGCTCGCAAGGTGGTTTTTAAAAGGAAACTATCACTCTTTTTCC

CAGTGTGGTTGTTCTGTGCCCTGATTTTTATATTTTGGGTGTGTAAAAAGTTGTAAACAATTTTTTCTGATTCTCATGTTGAAATAGTAAGAGAAGTTGG

GGGTAGAAATTATATCGCTCACATTTGAATGTGGTAGTTGGTATTTGAGGGGAGGGATGCTGTCTGTCACAAAACAGCTCCCCCAAGCGGTTCCCCAGAC

ATAAAATTTTAGAATTCGCCCTACCCTGTGAGAGGTTAGGCTCTAAGCATGCTAATTTATAGCTAGAAGGAACAGCACAAGCCTGATTATGTTGCATTTA

CCACCCACTTTCAGTAAGTAAAGTAAGACACATCACTGAGTAGCAAAGAACACTTTATGATGGAAGTGGAGAGGGCAGAAAGAAAACCCAAAGCATACGC

AGGAGTCAGTTCCTGGTACCGTAGAGTGAGAAAGACACCTGTGCAGGGAAGGGCCCACTGTGGTCAGGAAAGCAGACAACAGGATGGGAAGAACTCTACC

TCACAGTTTACATAGCAGATAGTTATGTTTTGTAGACATTTTAGCCTTTAAATGTCACAGTCTTCATCTTTTCAGCCCACCTTTGTTAGTTTCATACTTG

GGTGAATTTTTTCTACTGTGTATTATCCTCATCTTCTGTTCTATTAAACAATATCCACCTGTGAAATTACGGTCATATGTTTCCAATACCCATGTTCAGA

TACCAGTGTGTGATTTACCTTTCCTATGGGATTTCTAAGGGCTGGGAAATTTGGCTTCTACTGTATATCCTTATAATGTGCCCACATTGTAAATATGCAA

TAAAACCATAAAAAATACAAGGGCAGCAGATTTTCATATGTATTTCTTTGCCATGTTGTTTTTTGACAAGTTTGATTTCTGTAAATAAAGATTATTCATA

AAATCTA
Translation
 MEASVILPILKKKLAFLSG GGKDRRSGLILTIPLCLEQTSMDELSVTLDYLLSIPS SEKCKARGFTVIVDGRKSQWNVVKTVVLMLQ NVVPAEVSL

VCVVKPDEFWDKKVTHFCFWKEKDRLGFE VILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRL VFEKFTKESTSLLDELALINNGSDKGNEQEK

ER RSVDLNFLPSVDPETVLQTG GHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQ VVNW

LEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHS EWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFRQNLLQAALEFHGV

AQD LSQQLDGLLGMLCVDVAPADGASIQQTLKLLEEKLKSVD DVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQGVMEDMQLRKQR R

CEDMVDVRRLKMLQMVQLFKCEEDASQ AVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQ STYDYGRQLLQATVVLCQSLRCTSRSSGDT

LPRLNRVWKQFTVASEERVHRLEMAIAFHSNAEK ILQDCPEEPEAMNDEEQFEEIEAIGKSLLDRLTIPVVYPDG GTEQYFGSPSDMASTAEHIRDRM

KLVSLKRQQLRHPELVTTES
Transcript ENSMUST00000102659
Sequence
CGTCCCCAACGCCCGCCAGCCCGGCCCGCGCCAGCCAG - UNI22378 - AGGCAAGGACGTGAAATGGAGGCCTCGGTGATATTGCCCATTCTGAAG

AAGAAGCTGGCCTTCCTTTCAG GAGGAAAGGACAGACGCAGTGGACTCATCTTGACAATTCCGCTGTGCCTTGAGCAGACAAGTATGGATGAGCTGAGT

GTCACTTTGGATTATCTACTCAGCATTCCAAG TGAGAAATGTAAGGCCAGAGGATTCACTGTGATCGTGGATGGCAGGAAGTCTCAGTGGAATGTGGTG

AAGACAGTTGTCTTAATGCTGCAG AATGTTGTTCCAGCCGAGGTATCCCTTGTTTGTGTAGTGAAGCCAGATGAATTCTGGGATAAGAAAGTAACACAC

TTTTGTTTTTGGAAAGAAAAGGACAGACTTGGCTTTGAG GTTATTTTAGTGTCCGCCAATAAGTTGACGCGTTACATAGAGCCATGCCAGTTGACAGAA

GACTTTGGTGGGAGTCTCACCTATGACCACATGGACTGGCTGAATAAGAGGCTG GTCTTTGAGAAGTTTACAAAGGAGTCTACATCATTGCTAGATGAA

CTTGCTCTGATTAACAATGGAAGTGATAAGGGGAATGAGCAGGAGAAAGAAAG GTCTGTGGATTTAAACTTTCTTCCATCCGTTGATCCTGAGACGGTT

CTTCAGACAG GGCATGAGTTGTTATCTGAATTACAGCAGCGTCGATTTAATGGCTCCGACGGAGGGGTCTCGTGGTCTCCTATGGATGACGAGCTGCTG

GCACAGCCGCAGGTTATGAAGTTGCTGGACTCACTCCGGGAGCAGTACACGCGCTACCAGGAAGTCTGCAGGCAGCGCAGTAAGCGCACACAGCTGGAGG

AGATCCAGCAGAAGGTGATGCAG GTTGTGAACTGGCTTGAAGGGCCTGGATCTGAGCAACTGAGAGCACAGTGGGGCATTGGTGACTCGATCAGGGCCT

CCCAGGCCCTGCAACAGAAGCATGAGGAGATCGAGAGCCAACACAGC GAGTGGTTCGCAGTATACGTGGAGCTTAACCAGCAGATTGCAGCACTCTTAA

ACGCTGGAGACGAGGAAGATCTTGTGGAGTTGAAGTCTCTACAGCAACAGCTTAGCGACGTTTGCTATCGACAGGCCAGTCAGCTAGAATTTAGGCAAAA

CCTCCTGCAGGCAGCTTTGGAATTTCATGGTGTGGCCCAAGAT TTGTCTCAGCAGTTGGACGGCTTATTAGGGATGTTGTGCGTAGATGTAGCACCAGC

TGATGGAGCATCGATTCAGCAAACTTTAAAACTGCTTGAAGAGAAGCTGAAAAGTGTTG ATGTAGGATTGCAAGGCTTGCGAGAAAAAGGTCAAGGTCT

CCTGGATCAGATCTCCAACCAGGCTTCCTGGGCCTATGGCAAGGATGTAACTATTGAAAATAAAGAAAACGTGGACCACATACAAGGAGTGATGGAAGAC

ATGCAACTTAGGAAACAAAG ATGTGAGGACATGGTAGATGTGCGGAGGCTGAAGATGCTTCAGATGGTGCAGTTGTTTAAGTGTGAAGAGGATGCTTCA

CAG GCAGTAGAATGGCTGAGTGAACTTCTGGATGCCCTGCTGAAGACCCATATCAGGCTGGGTGACGATGCTCAGGAAACAAAGGTTTTACTGGAAAAA

CACAGAAAATTTGTCGATGTTGCCCAG AGTACTTACGACTATGGCAGACAGCTGCTGCAGGCCACAGTTGTACTGTGCCAGTCTCTGCGCTGCACTTCC

CGGTCCTCAGGGGACACACTTCCTCGACTGAACAGAGTGTGGAAGCAGTTTACAGTCGCATCTGAAGAGAGAGTGCACAGGTTGGAGATGGCTATTGCCT

TTCACTCCAATGCCGAAAAG ATTTTGCAAGACTGCCCAGAAGAGCCTGAAGCAATGAATGATGAGGAACAGTTTGAGGAAATTGAAGCAATTGGAAAAT

CACTTCTGGATAGACTCACTATCCCCGTGGTTTACCCCGACGG AACTGAACAATATTTTGGAAGTCCAAGTGACATGGCTTCTACTGCAGAGCACATCA

GGGACAGAATGAAACTGGTCAGTCTCAAAAGGCAGCAGCTGAGACATCCCGAATTGGTGACCACGGAGAGCTAATGTCCCCAGCTCCCGCAGATCTGCAG

GTCATACGCCCACATTCTTTGCTGCTGGCATTCTCTGGGGTTAGCCACAGCTCGTTAAGATGCATTTCACAGCGGGATAAGCCTCCTTTCTTCCCACGAC

ACGTGTCTCTCTCTAAATGCTAACATTTCTCCACCACCAAGGCATAGTCACAACATGCTTTGAGACTGTAGACTCCTGGTATCCTAAGAGAAGGAATTGT

AACCACCGCACTGAGTCCTCGCTTTCACGCCGTACCTGACTTGTCAGTTTGTAGCCAAACAACCAATACTAAGCTTTGAATGGTGCTAATCAGAGTTTAG

GAATTCTCTATAAAACATGGCTGCCCTTCCTCCCCAGGTGATGTAGGATATTTAGACCATAGTTAGACTGTTAGTGAATAGTGGTGTCCTCAAAATTTTA

CTTTGTAATTCTTCAAAATTGATTATTTTTAATGTCTATATGAAGAAAACCCTTCAGATCTTTGATATATCATATTCATTGAAAGACATTTTCCTATTGT

ATTCATAATGTATTAAAAGTTGTTTGTGCTTAATAAAAATCTTCTTTAAA
Translation
 - UNI22378 - MEASVILPILKKKLAFLSG GGKDRRSGLILTIPLCLEQTSMDELSVTLDYLLSIPS SEKCKARGFTVIVDGRKSQWNVVKTVVL

MLQ NVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFE VILVSANKLTRYIEPCQLTEDFGGSLTYDHMDWLNKRL VFEKFTKESTSLLDELAL

INNGSDKGNEQEKER RSVDLNFLPSVDPETVLQTG GHELLSELQQRRFNGSDGGVSWSPMDDELLAQPQVMKLLDSLREQYTRYQEVCRQRSKRTQLE

EIQQKVMQ VVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHS EWFAVYVELNQQIAALLNAGDEEDLVELKSLQQQLSDVCYRQASQLEFR

QNLLQAALEFHGVAQD LSQQLDGLLGMLCVDVAPADGASIQQTLKLLEEKLKSVD DVGLQGLREKGQGLLDQISNQASWAYGKDVTIENKENVDHIQG

VMEDMQLRKQR RCEDMVDVRRLKMLQMVQLFKCEEDASQ AVEWLSELLDALLKTHIRLGDDAQETKVLLEKHRKFVDVAQ STYDYGRQLLQATVVLC

QSLRCTSRSSGDTLPRLNRVWKQFTVASEERVHRLEMAIAFHSNAEK ILQDCPEEPEAMNDEEQFEEIEAIGKSLLDRLTIPVVYPDG GTEQYFGSPS

DMASTAEHIRDRMKLVSLKRQQLRHPELVTTES

For any suggestions or comments, please send an email to unitrap@crg.es