Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042284 (Itga1)
Chromosomal location
Chr 13: 115750287 - 115892172 (-)
Description
integrin alpha 1 Gene [Source:MGI Symbol;Acc:MGI:96599]
RefSeq_dna
NM_001033228 
RefSeq_peptide
NP_001028400.2 
UniGene
Mm.475910 
MGI
MGI:96599 
Uniprot/SWISSPROT
Q3V3R4 
Uniprot/SPTREMBL
Q3URV2 Q05DI0 Q3V391 Q8BPT3 
Human Ortholog
ENSG00000213949 (ITGA1)
Omim not available
UniTrap UNI12113
Vector Insertion
Chr 13: 115787272 - 115791746
Public Clones G022B11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036276
Sequence
GGGATTTGGTTCGTGAAGCAAGATCGCCCTCTCAGTGAAAGGCAGATGTCCCTTTAAGGTTTGCTTTGCTGCTGCCTGTGGACTTTAGCCTAAACACGGT

CCCGCGAAGTTGGCTTTATTTGTCCATGTCTCGGACAGAGCCTGGGTGGCTGCCAGTGAGATTTCAGAGACTTGAGCGCAAAGGGGCGGGAGATGTGGCA

ATCCATCTGGGATCTGAGAAGCGTGGAGCGGGCTTAGCAGCATTCGACCAAAACACAGGAAATTACTCTTCCACCGCTCCAGGGCGCTGCAGCCGCTGGG

GCCGCTGCCGGACACCCGCGGAGACCGCACCGAGTGACCCAGAGCGCAAGTCGCCGGCGCCTGGCTTCTGCCTGTTCCTGCCAGCTCCTGCCCACGAACC

AGTACGTCGCTGGTTCCAGCAGCCACTCCAGCAATGGTCCCCAGGCGTCCTGCTAGCCTAGAGGTCACTGTAGCCTGCATCTGGCTTCTCACCG TTATC

CTAGGCGTCTGCATCTCCTTCAACGTTGATGTCAAAAACTCCATGAGCTTCAGTGGTCCAGTGGAGGACATGTTTGGATACACCGTTCAACAGTATGAAA

ACGAAGAAGGCAAATG GGTTCTTATTGGTTCTCCTTTAGTTGGCCAACCCAAAGCAAGAACTGGAGATGTCTATAAGTGTCCAGTTGGGAGAGAGAGAT

CAATGCCTTGTGTGAAGTTGGATTTACCAG TTAACACATCGATTCCTAATGTCACAGAAATAAAGGAAAACATGACATTTGGATCAACTTTAGTCACCA

ATCCGAAGGGAGGATTTCTG GCATGTGGGCCCTTGTATGCCTATAGATGTGGACATTTGCATTATACGACTGGCATATGTTCTGATGTCAGCCCTACAT

TTCAAGTTGTGAACTCGTTCGCCCCTGTACAAG AATGTAGCACACAGCTTGACATAGTCATCGTCCTAGATGGCTCCAACAGCATCTACCCCTGGGAAA

GTGTCACTGCCTTTTTAAACGACCTTCTTAAGAGGATGGACATTGGCCCCAAACAGACACAG GTTGGAATTGTACAATATGGAGCAAATGTAACACATG

AGTTCAACCTCAATAAGTATTCATCCACAGAAGAGGTCCTGGTGGCAGCAAACAAAATAGGCCGCAGGGGTGGTCTCCAGACGATGACAGCCCTTGGAAT

AGACACAGCCAG GAAAGAGGCATTCACTGAAGCTCGGGGGGCCAGAAGGGGAGTGAAAAAAGTCATGGTTATTGTGACTGATGGAGAATCGCATGACAA

CTATCGCCTGAAACAGGTCATCCAAGACTGTGAGGATGAAAACATTCAGCGATTTTCCATAGCT AAAACATTTTTAACAAGCTACCAGACCCTTGGGTG

A
Translation
MVPRRPASLEVTVACIWLLTV VILGVCISFNVDVKNSMSFSGPVEDMFGYTVQQYENEEGKW WVLIGSPLVGQPKARTGDVYKCPVGRERSMPCVKLD

LPV VNTSIPNVTEIKENMTFGSTLVTNPKGGFL ACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVQE ECSTQLDIVIVLDGSNSIYPWESVTA

FLNDLLKRMDIGPKQTQ VGIVQYGANVTHEFNLNKYSSTEEVLVAANKIGRRGGLQTMTALGIDTAR RKEAFTEARGARRGVKKVMVIVTDGESHDNY

RLKQVIQDCEDENIQRFSIA KTFLTSYQTLG
Transcript ENSMUST00000061673
Sequence
GGGATTTGGTTCGTGAAGCAAGATCGCCCTCTCAGTGAAAGGCAGATGTCCCTTTAAGGTTTGCTTTGCTGCTGCCTGTGGACTTTAGCCTAAACACGGT

CCCGCGAAGTTGGCTTTATTTGTCCATGTCTCGGACAGAGCCTGGGTGGCTGCCAGTGAGATTTCAGAGACTTGAGCGCAAAGGGGCGGGAGATGTGGCA

ATCCATCTGGGATCTGAGAAGCGTGGAGCGGGCTTAGCAGCATTCGACCAAAACACAGGAAATTACTCTTCCACCGCTCCAGGGCGCTGCAGCCGCTGGG

GCCGCTGCCGGACACCCGCGGAGACCGCACCGAGTGACCCAGAGCGCAAGTCGCCGGCGCCTGGCTTCTGCCTGTTCCTGCCAGCTCCTGCCCACGAACC

AGTACGTCGCTGGTTCCAGCAGCCACTCCAGCAATGGTCCCCAGGCGTCCTGCTAGCCTAGAGGTCACTGTAGCCTGCATCTGGCTTCTCACCG TTATC

CTAGGCGTCTGCATCTCCTTCAACGTTGATGTCAAAAACTCCATGAGCTTCAGTGGTCCAGTGGAGGACATGTTTGGATACACCGTTCAACAGTATGAAA

ACGAAGAAGGCAAATG GGTTCTTATTGGTTCTCCTTTAGTTGGCCAACCCAAAGCAAGAACTGGAGATGTCTATAAGTGTCCAGTTGGGAGAGAGAGAT

CAATGCCTTGTGTGAAGTTGGATTTACCAG TTAACACATCGATTCCTAATGTCACAGAAATAAAGGAAAACATGACATTTGGATCAACTTTAGTCACCA

ATCCGAAGGGAGGATTTCTG GCATGTGGGCCCTTGTATGCCTATAGATGTGGACATTTGCATTATACGACTGGCATATGTTCTGATGTCAGCCCTACAT

TTCAAGTTGTGAACTCGTTCGCCCCTGTACAAG AATGTAGCACACAGCTTGACATAGTCATCGTCCTAGATGGCTCCAACAGCATCTACCCCTGGGAAA

GTGTCACTGCCTTTTTAAACGACCTTCTTAAGAGGATGGACATTGGCCCCAAACAGACACAG GTTGGAATTGTACAATATGGAGCAAATGTAACACATG

AGTTCAACCTCAATAAGTATTCATCCACAGAAGAGGTCCTGGTGGCAGCAAACAAAATAGGCCGCAGGGGTGGTCTCCAGACGATGACAGCCCTTGGAAT

AGACACAGCCAG GAAAGAGGCATTCACTGAAGCTCGGGGGGCCAGAAGGGGAGTGAAAAAAGTCATGGTTATTGTGACTGATGGAGAATCGCATGACAA

CTATCGCCTGAAACAGGTCATCCAAGACTGTGAGGATGAAAACATTCAGCGATTTTCCATAGCT ATCCTTGGCCACTATAACAGGGGGAACTTAAGCAC

CGAAAAATTTGTGGAGGAGATAAAATCAATCGCAAGTGAGCCCACCGAAAAGCACTTCTTCAACGTCTCAGATGAGTTGGCCCTGGTCACTATTGTTAAA

GCTCTGGGAGAAAGGATATTTGCTTTGGAAG CTACAGCTGACCAGTCAGCAGCTTCGTTTGAAATGGAGATGTCTCAGACCGGCTTCAGTGCTCATTAT

TCACAG GACTGGGTCATGCTTGGAGCTGTTGGAGCCTATGACTGGAACGGAACTGTGGTCATGCAGAAGGCTAACCAGATTGTCATCCCTCATAACACC

ACCTTTCAAACTGAGCCCACCAAGATGAACGAGCCTCTTGCTTCTTACTTGG - UNI12113 - GTTACACAGTGAACTCTGCCACCATCCCGGGAGA

TGTGCTCTATATCGCTGGGCAGCCTCGGTACAATCACACCGGCCAGGTCGTCATCTACAAGATGGAGGATGGGGACGTCAACATTCTGCAGACACTCAGT

GGAGAGCAG ATCGGATCCTACTTTGGTAGCGTCTTAACCACAATTGACATCGACAAAGATTCTTACACTGATCTGCTTCTCGTCGGGGCTCCCATGTAT

ATGGGGACAGAGAAAGAGGAACAGGGCAAGGTGTACGTGTACGCTGTGAATCAG ACGAGGTTTGAATATCAAATGAGCCTGGAACCAATTAAGCAGACC

TGCTGTTCATCCCTGAAGGATAATTCATGCACAAAAGAAAACAAGAATGAGCCCTGTGGGGCCCGTTTTGGAACAGCAGTTGCTGCTGTAAAAGACCTCA

ACGTGGATGGCTTTAATGACGTCGTGATTGGAGCTCCCCTGGAAGACGACCACGCAGGAGCTGTGTACATTTATCATGGCAGTGGCAAGACCATAAGGAA

AGAGTATGCGCAA CGCATTCCCTCAGGTGGGGATGGGAAGACGCTGAAATTTTTTGGCCAGTCTATCCACGGAGAGATGGATTTAAATGGCGATGGTCT

GACTGACGTGACCATTGGAGGCCTTGGAGGAGCTGCCCTCTTCTG GGCCAGAGATGTGGCTGTAGTTAAAGTGACCATGAATTTTGAACCCAACAAAGT

GAATATTCAAAAGAAAAACTGCCGTGTGGAGGGCAAAGAAACAGTATGCATAAATGCTACAATGTGTTTTCATGTGAAATTGAAGTCTAAAGAAGACTCA

GTTTACGAGGCTG ATCTGCAGTACCGTGTCACCCTTGATTCGCTGAGGCAGATATCACGGAGCTTTTTTTCTGGAACTCAGGAAAGGAGGATTCAAAGA

AACCTCACCGTTCGAGAATCCGAATGCATCAGGCACTCCTTCTACATGTTG GATAAGCACGACTTTCAGGACTCCGTGAGAGTGACTTTGGATTTTAAC

CTCACTGATCCAGAAAATGGGCCCGTGCTCGATGACGCTCTGCCAAACTCAGTCCATGGACAT ATTCCTTTTGCCAAAGACTGTGGGAACAAGGAAAGA

TGCGTTTCAGACCTCACCCTGGATGTGTCCACAACAGAAAAGAACCTGCTGATTGTCAGATCCCAGAATGACAAGTTCAATGTCAGCCTCACCGTCAAAA

ACAAGGGAGACAGTGCGTACAACACCCGGACAGTGGTTCAGTATTCTCCAAATCTGATTTTTTCAGGAATTGAG GAGATCCAAAAAGATAGCTGCGAAT

CCAATCAAAATATCACGTGTAGAGTTGGATATCCTTTCCTGAGGACAGGAGACGTG GTTAACTTCAAAATAATATTCCAGTTTAATACATCACATCTCT

CAGAAAATGCAATTATTCATTTAAGTGCAACAAG TGACAGTGAAGAGCCCCTGGAATCTCTTTACGATAATGAAGTAAATATTTCCATCCCCGTAAAAT

ATGAAGTCGGACTGCAGTTTTACAG TTCTGCGAGTGAACACCACATTTCAGTTGCTGCCAATGAGACTGTTCCTGAGCTGATTAATTCCACCAAGGACA

TTGGGGATGAAATTAATGTCTTCTACACG ATTAGAAAAAGAGGGCATTTCCCAATGCCAGAACTTCGGCTGGCAATTTCATTTCCCAATCTGACGTCAG

ATGGCTATCCTGTACTGTACCCAACTGGATGGTCATCTTCTGAT AATGTAAACTGCAGACCTCGAAGCCTTGAGGACCCTTTGGGTATCAACTCTGGGA

AGAAAATGACAATATCAAAGTCTGAGGTTCTCAAAAGAGGCACAATCCAG GACTGCAGTACCTGCAAGATTGCTACCATCACGTGTCATCTCCTTCCCT

CGGATGTGAGTCAAGTGAATGTCTCACTCATCTTGTGGAAACCAACTTTCATAAAA GCACATTTTTCCAGCTTAAATCTTACCATACGGGGAGAACTTC

AGAGTGAAAACTCATCGCTGACTTTAAGCAGCAGCAACCGGAAACGAGAG CTGGCTATTCAGATATCCAAAGACGGGCTCCCAGGCCGAGTGCCGCTGT

GGGTTATCCTCCTGAGCGCCTTTGCGGGACTCCTGCTGTTAATGCTGCTTATATTAGCTCTGTGGAAG ATTGGATTCTTCAAAAGGCCACTAAAGAAGA

AAATGGAGAAATGAAATATTTAAGG
Translation
MVPRRPASLEVTVACIWLLTV VILGVCISFNVDVKNSMSFSGPVEDMFGYTVQQYENEEGKW WVLIGSPLVGQPKARTGDVYKCPVGRERSMPCVKLD

LPV VNTSIPNVTEIKENMTFGSTLVTNPKGGFL ACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSFAPVQE ECSTQLDIVIVLDGSNSIYPWESVTA

FLNDLLKRMDIGPKQTQ VGIVQYGANVTHEFNLNKYSSTEEVLVAANKIGRRGGLQTMTALGIDTAR RKEAFTEARGARRGVKKVMVIVTDGESHDNY

RLKQVIQDCEDENIQRFSIA ILGHYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKALGERIFALEA ATADQSAASFEMEMSQTGFSAH

YSQ DWVMLGAVGAYDWNGTVVMQKANQIVIPHNTTFQTEPTKMNEPLASYLG - UNI12113 - GYTVNSATIPGDVLYIAGQPRYNHTGQVVIYKM

EDGDVNILQTLSGEQ IGSYFGSVLTTIDIDKDSYTDLLLVGAPMYMGTEKEEQGKVYVYAVNQ TRFEYQMSLEPIKQTCCSSLKDNSCTKENKNEPCG

ARFGTAVAAVKDLNVDGFNDVVIGAPLEDDHAGAVYIYHGSGKTIRKEYAQ RIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFW WAR

DVAVVKVTMNFEPNKVNIQKKNCRVEGKETVCINATMCFHVKLKSKEDSVYEAD DLQYRVTLDSLRQISRSFFSGTQERRIQRNLTVRESECIRHSFYM

L DKHDFQDSVRVTLDFNLTDPENGPVLDDALPNSVHGH IPFAKDCGNKERCVSDLTLDVSTTEKNLLIVRSQNDKFNVSLTVKNKGDSAYNTRTVVQY

SPNLIFSGIE EIQKDSCESNQNITCRVGYPFLRTGDV VNFKIIFQFNTSHLSENAIIHLSATS SDSEEPLESLYDNEVNISIPVKYEVGLQFYS SS

ASEHHISVAANETVPELINSTKDIGDEINVFYT IRKRGHFPMPELRLAISFPNLTSDGYPVLYPTGWSSSD NVNCRPRSLEDPLGINSGKKMTISKSE

VLKRGTIQ DCSTCKIATITCHLLPSDVSQVNVSLILWKPTFIK AHFSSLNLTIRGELQSENSSLTLSSSNRKRE LAIQISKDGLPGRVPLWVILLSA

FAGLLLLMLLILALWK IGFFKRPLKKKMEK

For any suggestions or comments, please send an email to unitrap@crg.es