Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042302 (Ehbp1)
Chromosomal location
Chr 11: 21905831 - 22185841 (-)
Description
EH domain binding protein 1 Gene [Source:MGI (curated);Acc:Ehbp1-001]
RefSeq_dna
NM_153078 
RefSeq_peptide
NP_694718.2 
UniGene
Mm.281732 
MGI
MGI:2667252 
Uniprot/SWISSPROT
Q69ZW3 
Uniprot/SPTREMBL
Q5SS55 
Human Ortholog
ENSG00000115504 (EHBP1)
Omim 611868 - PROSTATE CANCER, HEREDITARY, 12  
UniTrap UNI29361
Vector Insertion
Chr 11: 22148031 - 22185490
Public Clones Ayu21-T3 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22041
Vector Insertion
Chr 11: 22139242 - 22147972
Public Clones not available
Private Clones OST310816 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34330
Vector Insertion
Chr 11: 22072827 - 22132059
Public Clones (sanger) IST11942F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6709
Vector Insertion
Chr 11: 21914958 - 21953434
Public Clones HMA423 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093276
Sequence
AATGATGATGTCTCCATGAGGGAACCTCCTCTCAGTCATCCTGTCCTGTACATCAGCTGTTCTTGACTGGGCCATTGATCTAAGATAGGATTTACCCTGT

GAGACAGGGAGAAGACTTATGGACGCCAAGCATCATTTCAAGTTCTAGTTTTTGTTGAAAGTACTGACATACATGCAAGGCTCGTGTGCTTTATCAAAGC

TGCTGTGTTGCTAATCCAGAACTGTTCCAGTCTCTTGGCCTATCACCATGGCTTCAGTTTGGAAGCGACTGCAGCGTGTGGGAAAACATGCATCCAAGTT

CCAGTTTGTGGCCTCCTACCAGGAGCTGATGGTTGAATGTACAAAGAAATG - UNI29361 - GCAACCAGATAAACTGGTGGTTGTTTGGACAAGAA

GAAGCCGAAGGAAGTCTTCCAAG - UNI22041 - GCTCACAGCTGGCAACCTGGAATAAAAAATCCATATCGTGGTGTTGTTGTTTGGCCTGTTCCT

GAAAACATTGAAATCACTGTGACGCTGTTTAAG - UNI34331 - GATCCTCATGCAGAAGAATTTGAAGACAAAGAATGGACATTTGTCATTGAGAA

T - UNI34331 - GAATCCCCTTCTGGTCGGAGGAAAGCTCTTGCCACCAGCAGCATTAACATGAAACAGTACGCAAGCCCCATGCCAACACAAACTG

ACGTCAAGTTAAAATTCAAGCCGCTGTCTAAGAAGGTCGTGTCTGCCACTCTCCAGTTCTCACTGTCCTGTATCTTCCTTCGGGAGGGAAAAGCAAC - 

UNI34331 - GGATGAAGATATGCAGAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCAGACATTGGCAATTTAGATGATTTCGAAGAAGATAATGAGG

ATGATGACGAGAACCGTGTGAACCAAGAGGAGAAGGCGGCAAAAATTACAG AACTTATAAACACACTTAACTTTTTGGATGAAGCACAAAAGGACTTGG

CCACTGTGAATACCAATCCATTTGATGAACCTGATGTAACAGAATTAAATCCATTTGGAGATCCTGACTCAGAAG AACCAATCACTGAAACAACTTCAC

CTAAAAAACCAGAAGAATCTTTTTATAATAACAGCTGTAATCCCTTTAAAGGTGTACAGACTCCACAGTATTTGAACCCATTTGATGAACCAGAAACTTT

TGTAATGATAAAGGATTCTCCACCCCAGTCTACACGAAGAAAA
Translation
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKW - UNI29361 - WQPDKLVVVWTRRSRRKSSK - UNI22041 - AHSWQPGIKNPYRGVVV

WPVPENIEITVTLFK - UNI34331 - DPHAEEFEDKEWTFVIEN - UNI34331 - ESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSK

KVVSATLQFSLSCIFLREGKAT - UNI34331 - TDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKITE ELINTLNFLDEAQKD

LATVNTNPFDEPDVTELNPFGDPDSEE EPITETTSPKKPEESFYNNSCNPFKGVQTPQYLNPFDEPETFVMIKDSPPQSTRRK
Transcript ENSMUST00000045167
Sequence
AATGATGATGTCTCCATGAGGGAACCTCCTCTCAGTCATCCTGTCCTGTACATCAGCTGTTCTTGACTGGGCCATTGATCTAAGATAGGATTTACCCTGT

GAGACAGGGAGAAGACTTATGGACGCCAAGCATCATTTCAAGTTCTAGTTTTTGTTGAAAGTACTGACATACATGCAAGGCTCGTGTGCTTTATCAAAGC

TGCTGTGTTGCTAATCCAGAACTGTTCCAGTCTCTTGGCCTATCACCATGGCTTCAGTTTGGAAGCGACTGCAGCGTGTGGGAAAACATGCATCCAAGTT

CCAGTTTGTGGCCTCCTACCAGGAGCTGATGGTTGAATGTACAAAGAAATG - UNI29361 - GCAACCAGATAAACTGGTGGTTGTTTGGACAAGAA

GAAGCCGAAGGAAGTCTTCCAAG - UNI22041 - GCTCACAGCTGGCAACCTGGAATAAAAAATCCATATCGTGGTGTTGTTGTTTGGCCTGTTCCT

GAAAACATTGAAATCACTGTGACGCTGTTTAAG - UNI34331 - GATCCTCATGCAGAAGAATTTGAAGACAAAGAATGGACATTTGTCATTGAGAA

T - UNI34331 - GAATCCCCTTCTGGTCGGAGGAAAGCTCTTGCCACCAGCAGCATTAACATGAAACAGTACGCAAGCCCCATGCCAACACAAACTG

ACGTCAAGTTAAAATTCAAGCCGCTGTCTAAGAAGGTCGTGTCTGCCACTCTCCAGTTCTCACTGTCCTGTATCTTCCTTCGGGAGGGAAAAGCAAC - 

UNI34331 - GGATGAAGATATGCAGAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCAGACATTGGCAATTTAGATGATTTCGAAGAAGATAATGAGG

ATGATGACGAGAACCGTGTGAACCAAGAGGAGAAGGCGGCAAAAATTACAG AAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAG

ATGACTGCATAAAGCAAGCAAATGTGCCCTCAGCTAAATCAGCCAGTTCCTCTGAAG AACTTATAAACACACTTAACTTTTTGGATGAAGCACAAAAGG

ACTTGGCCACTGTGAATACCAATCCATTTGATGAACCTGATGTAACAGAATTAAATCCATTTGGAGATCCTGACTCAGAAG GTGTACAGACTCCACAGT

ATTTGAACCCATTTGATGAACCAGAAACTTTTGTAATGATAAAGGATTCTCCACCCCAGTCTACACGAAGAAAAAACCTAAGACCTGTAGACATGAGCAA

GTACCTCTATGCTGATAGTTCAAAGAGTGAAGAGGAACTGGATGA ATCAAATCCTTTTTATGAGCCTAAGCCAACTTCTCCAAATAATTTGGTCAATAC

AGTTCAAGAAGGGGAAACTGAACGGAGAGTGAAAAGAAGGGCCCCAGCCCCGCCGGCCCCACTAGCCCCGCCAGCCCCGCCAGCCCCACCAGCCCTCACA

CCCAAGACTGGAGTAAATGAAAACACAGTTGTCTCTGCAGGGAAAGATCTCTCTACTTCTCCAAAG CCAAGCCCGATACCAAGTCCTGTTCTGGGGCAA

AAGCCAAACGCTAGTCAGTCGCTGCTTGCATGGTGCAGAGAAGTTACAAAAAACTACCGGGGCGTGAAAATCACCAACTTTACCACATCGTGGAGGAATG

GCTTATCATTCTGTGCAATTTTACACCACTTTAGACCAGACTTAAT CGACTACAAGTCTCTGAATCCTCAAGATATTAAAGAAAACAACAAAAAG GCT

TACGATGGATTTGCCAGCATTGGAATTTCCCGTTTACTGGAACCTTCTGATATGGTTTTATTAGCAATCCCTGACAAACTGACTGTTATGACTTATCTCT

ATCAAATAAGGGCACATTTTAGCGGACAAGAACTAAATGTGGTTCAGATAGAGGAAAACAGCAGTAAGAGCACATATAAAGTTGGAAATTATGAGACAGA

CACAAACAGTTCTGTGGATCAAGAAAAGTTCTACGCTGAACTCAGCGATCTGAAGCGAGAGCCTGAACCTCACCAGCCTGCCCGTGGGGCTGTGGATCTG

CTGTCGCAGGATGACTCTGTGTTTGTAACTGACAGTGGGGTGGGAGAGTCTGAAAGTGAACACCAGACTCCAGATGACCACCTTAGTCCAAGCACAGCCT

CCCCTTACTACCGCAGGACTAAGAGTGACACGGAGCCCCAAAAGTCGCAGCAGAGCTCCGCGAGGACTTCAGGGTCTGATGACCCTGGGTTAAGTTCTAG

TACTGATTCAGCTCAAGCCCTGGCTTCCTTAGGCAAGAAGAGACTAAAAGCTGAGAACTTGGAACTAAGTGACTTATGTGTCAGTGACAAGAAGAAGGAT

GTGTCTCCACTCTCAGCTTACGAGCAAAAGCTTCAGACTGTACATGCCAGCAGTGATATGGAACAAGGGAAAATGGAGAAGTCCAGATCTTTAGAATGCA

GATTGGATGGTGAATTGGCTATCACAAAGCCAAATGTATCCTCTCCTTCTAAACTTGGATATAACAGAGACACAGACTTCACGAAAAAACCATGTGCTTC

TCTGAGGCAGATAGAGTCTGATCCAGATGCAGACAAGAGCACTTTAAATCATGCAGACCACCCCAACAAAGCAGTTCAG CACCGAATGTTGTCCAGACA

AGAGGAGCTGAAAGAAAGAGCGAGAGTTCTGCTTGAGCAAGCAAGAAGAGATGCTGCTTTCAAGGTGGGGAGCAAGCATGGTGGCAGCGCAGCCCCTGCG

CTCTGCAGCAGACAGCTAAATGAT CAGCAAGATGAAGAGAGACGTCGGCAGCTGAGAGAGAGGGCTCGTCAGCTAATAGCAGAAGCTCGATGCGGAGTG

AAGATGTCAGAACTTCCCAGCTATGGTGAAATGGCTGCAGAAAAGTTGAAAGAAAGGTCAAAGGCATCTGGAG ATGAAAATGATAATATTGAGATAGAT

ACTAACGAAGAGATTCCTGAAGGCTTTGTTGTAGGAGGTGGAGATGAACTTACTAATATAGAAAGTGACCTTGATAATCCCG AGCAGAATAGTAAGGTG

GTGGACTTGAGGCTGAAGAAGCTATTAGAAGCCCAGCCACAGGTGGCAAACTTACTCCCCAGTGCTGCGCAGAAAGCTGTAACCGAGGCCTCCGAGCAAG

GAGAAAAG AGTGGCGTGGAAGATCTCCGGACTGAACGATTACAAAAAGCAACAGAACGTTTCAGAAATCCTGTTGTGTTTAACAAGGATTCCACAGTCA

GAAAGACTCAGCTCCAGTCTTTCAGTCAGTATGTTGAGAACAGACCAG AGATGAAAAGACAGAGATCAATACAGGAAGATACAAAGAGAGGAACTGAGG

AGAAGGCAGAGATAACTGAAACTCAGAGGAAGCCATCAGAAGATGAA AAAGGGTTCAAAGACACCAGTCAGTATGTTGTAGGGGAATTGGCAGCACTGG

AGAATGAGCAGAAGCAAATTGACACCCGTGCCGCGCTGGTGGAGAAGCGCCTCCGCTATCTCATGGACACAG - UNI6709 - GAAGGAACACGGAAG

AAGAGGAGGCGATGATGCAGGAATGGTTCATGCTGGTTAATAAGAAAAATGCCTTAATAAGGAGGATGAACCAGCTTTCCCTCCT GGAAAAAGAGCATG

ACTTAGAACGAAGGTATGAGCTGCTGAACCGGGAGCTACGGGCCATGCTAGCCATTGAAG ACTGGCAGAAGACCGAGGCCCAGAAGCGACGGGAACAGC

TCCTGCTGGATGAACTAGTAGCCCTGGTGGACAAGCGAGACGCCCTTGTCAGGGACCTGGACGCCCAGGAGAAGCA GGCCGAAGAAGAAGACGAGCATT

TGGAGCGAACTCTGGAGCAAAACAAAGGCAAGATGGCCAAGAAGGAGGAGAAGTGTGCTCTTCAGTAGTAGTAGCCTTGGACCAGACCTCTCCCCCACTA

CTTGAGTCTTAGGTCCCCAGGCCAGAAGCAGACTGGTTGACTTAAAACTTTTTAACATTTTGTTTGCCTGGATTGTACTTCTGGACCCACCCCTCCCCCA

TTTCCTCTTCTCCAGATAATACACAGAGCTCCAGATAGCTTTAAAGACTCTTTGAGTTAATCATGAAATCATTCTTGAAATCCTGTGAAGTAGATTTGCG

CAGACACCCCGTGAATGACTGGTACTGAAGATGCTCAAGAAACTGTCCAAAAAGGAGGGAGACTCCCTGGTTATCGCCCCTTCTGTTTTGGATGGGATGA

GAATCTGAAACATGTTTGTTGTAGTATTGTTGGTAATAGCGAAATGACAGTGGGTGGGGGGGCAAAGGGGAGTAAGAAAATGTCATGATTTTTTTTTCCA

ATCCCGCAGTATGTATGTGACACTGTTACTTAAATCTCATAGTTAGATCTTAGTCTGTGTATTGACGAAGCTGTGTTCCATTTGCCAGTGGGATTTTCTG

CAGTTGTTTACAATTCACATAAAGATAATAAAGTTCCTCTCTGCTCTCCTCAGAGGATGGCCCTGTAAGGTAGCCTGAGACAAACCTGGGGTTTGAAAGG

TGACCTGGGAGAACAGCTCTGTTCAATGTGCAGCAGTTTACAAAGACAGCTCATCAGCTGATGATGCACCATCTTATACTCTGAATAATTATTTATTACA

TCTTGCTTGGTTCCTACTTTTTGTTGGGGCTCAACATTGGCTCAAGAATGCTGTTAATATTTATTCTGTATTGATAAAAGTCTGTCTTGGCACTACAAGT

AAATATCCCATTACATCTTCTCTAGCATAGCACTGTGTGTTTTGTGAAAATGGTTATGTTTATTTATTACAATACTGAGTCATATATAAATTTTCAATAA

AAGCAGAAACTTTCTTACCTT
Translation
MASVWKRLQRVGKHASKFQFVASYQELMVECTKKW - UNI29361 - WQPDKLVVVWTRRSRRKSSK - UNI22041 - AHSWQPGIKNPYRGVVV

WPVPENIEITVTLFK - UNI34331 - DPHAEEFEDKEWTFVIEN - UNI34331 - ESPSGRRKALATSSINMKQYASPMPTQTDVKLKFKPLSK

KVVSATLQFSLSCIFLREGKAT - UNI34331 - TDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKITE EIVNQLNALSSLDED

QDDCIKQANVPSAKSASSSEE ELINTLNFLDEAQKDLATVNTNPFDEPDVTELNPFGDPDSEG GVQTPQYLNPFDEPETFVMIKDSPPQSTRRKNLRP

VDMSKYLYADSSKSEEELDE ESNPFYEPKPTSPNNLVNTVQEGETERRVKRRAPAPPAPLAPPAPPAPPALTPKTGVNENTVVSAGKDLSTSPK PSPI

PSPVLGQKPNASQSLLAWCREVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLI IDYKSLNPQDIKENNKK AYDGFASIGISRLLEPSDMVLLAIP

DKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREPEPHQPARGAVDLLSQDDSVFVTDSGVGESESEHQTP

DDHLSPSTASPYYRRTKSDTEPQKSQQSSARTSGSDDPGLSSSTDSAQALASLGKKRLKAENLELSDLCVSDKKKDVSPLSAYEQKLQTVHASSDMEQGK

MEKSRSLECRLDGELAITKPNVSSPSKLGYNRDTDFTKKPCASLRQIESDPDADKSTLNHADHPNKAVQ HRMLSRQEELKERARVLLEQARRDAAFKVG

SKHGGSAAPALCSRQLND QQDEERRRQLRERARQLIAEARCGVKMSELPSYGEMAAEKLKERSKASGD DENDNIEIDTNEEIPEGFVVGGGDELTNIE

SDLDNPE EQNSKVVDLRLKKLLEAQPQVANLLPSAAQKAVTEASEQGEK SGVEDLRTERLQKATERFRNPVVFNKDSTVRKTQLQSFSQYVENRPE E

MKRQRSIQEDTKRGTEEKAEITETQRKPSEDE KGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTG - UNI6709 - GRNTEEEEAMMQ

EWFMLVNKKNALIRRMNQLSLL LEKEHDLERRYELLNRELRAMLAIED DWQKTEAQKRREQLLLDELVALVDKRDALVRDLDAQEKQ QAEEEDEHLE

RTLEQNKGKMAKKEEKCALQ
Transcript ENSMUST00000109563
Sequence
AATGATGATGTCTCCATGAGGGAACCTCCTCTCAGTCATCCTGTCCTGTACATCAGCTGTTCTTGACTGGGCCATTGATCTAAGATAGGATTTACCCTGT

GAGACAGGGAGAAGACTTATGGACGCCAAGCATCATTTCAAGTTCTAGTTTTTGTTGAAAGTACTGACATACATGCAAGGCTCGTGTGCTTTATCAAAGC

TGCTGTGTTGCTAATCCAGAACTGTTCCAGTCTCTTGGCCTATCACCATGGCTTCAGTTTGGAAGCGACTGCAGCGTGTGGGAAAACATGCATCCAAGTT

CCAGTTTGTGGCCTCCTACCAGGAGCTGATGGTTGAATGTACAAAGAAATG - UNI29361 - GCAACCAGATAAACTGGTGGTTGTTTGGACAAGAA

GAAGCCGAAGGAAGTCTTCCAAG - UNI22041 - GCTCACAGCTGGCAACCTGGAATAAAAAATCCATATCGTGGTGTTGTTGTTTGGCCTGTTCCT

GAAAACATTGAAATCACTGTGACGCTGTTTAAG - UNI34331 - GATCCTCATGCAGAAGAATTTGAAGACAAAGAATGGACATTTGTCATTGAGAA

T - UNI34331 - GAATCCCCTTCTGGTCGGAGGAAAGCTCTTGCCACCAGCAGCATTAACATGAAACAGTACGCAAGCCCCATGCCAACACAAACTG

ACGTCAAGTTAAAATTCAAGCCGCTGTCTAAGAAGGTCGTGTCTGCCACTCTCCAGTTCTCACTGTCCTGTATCTTCCTTCGGGAGGGAAAAGCAAC - 

UNI34331 - GGATGAAGATATGCAGAGTTTGGCTAGTTTGATGAGTATGAAGCAGGCAGACATTGGCAATTTAGATGATTTCGAAGAAGATAATGAGG

ATGATGACGAGAACCGTGTGAACCAAGAGGAGAAGGCGGCAAAAATTACAG AAATTGTAAACCAGTTGAATGCTCTGAGCAGCTTAGATGAAGATCAAG

ATGACTGCATAAAGCAAGCAAATGTGCCCTCAGCTAAATCAGCCAGTTCCTCTGAAG AACTTATAAACACACTTAACTTTTTGGATGAAGCACAAAAGG

ACTTGGCCACTGTGAATACCAATCCATTTGATGAACCTGATGTAACAGAATTAAATCCATTTGGAGATCCTGACTCAGAAG AACCAATCACTGAAACAA

CTTCACCTAAAAAACCAGAAGAATCTTTTTATAATAACAGCTGTAATCCCTTTAAAGGTGTACAGACTCCACAGTATTTGAACCCATTTGATGAACCAGA

AACTTTTGTAATGATAAAGGATTCTCCACCCCAGTCTACACGAAGAAAAAACCTAAGACCTGTAGACATGAGCAAGTACCTCTATGCTGATAGTTCAAAG

AGTGAAGAGGAACTGGATGA ATCAAATCCTTTTTATGAGCCTAAGCCAACTTCTCCAAATAATTTGGTCAATACAGTTCAAGAAGGGGAAACTGAACGG

AGAGTGAAAAGAAGGGCCCCAGCCCCGCCGGCCCCACTAGCCCCGCCAGCCCCGCCAGCCCCACCAGCCCTCACACCCAAGACTGGAGTAAATGAAAACA

CAGTTGTCTCTGCAGGGAAAGATCTCTCTACTTCTCCAAAG CCAAGCCCGATACCAAGTCCTGTTCTGGGGCAAAAGCCAAACGCTAGTCAGTCGCTGC

TTGCATGGTGCAGAGAAGTTACAAAAAACTACCGGGGCGTGAAAATCACCAACTTTACCACATCGTGGAGGAATGGCTTATCATTCTGTGCAATTTTACA

CCACTTTAGACCAGACTTAAT CGACTACAAGTCTCTGAATCCTCAAGATATTAAAGAAAACAACAAAAAG GCTTACGATGGATTTGCCAGCATTGGAA

TTTCCCGTTTACTGGAACCTTCTGATATGGTTTTATTAGCAATCCCTGACAAACTGACTGTTATGACTTATCTCTATCAAATAAGGGCACATTTTAGCGG

ACAAGAACTAAATGTGGTTCAGATAGAGGAAAACAGCAGTAAGAGCACATATAAAGTTGGAAATTATGAGACAGACACAAACAGTTCTGTGGATCAAGAA

AAGTTCTACGCTGAACTCAGCGATCTGAAGCGAGAGCCTGAACCTCACCAGCCTGCCCGTGGGGCTGTGGATCTGCTGTCGCAGGATGACTCTGTGTTTG

TAACTGACAGTGGGGTGGGAGAGTCTGAAAGTGAACACCAGACTCCAGATGACCACCTTAGTCCAAGCACAGCCTCCCCTTACTACCGCAGGACTAAGAG

TGACACGGAGCCCCAAAAGTCGCAGCAGAGCTCCGCGAGGACTTCAGGGTCTGATGACCCTGGGTTAAGTTCTAGTACTGATTCAGCTCAAGCCCTGGCT

TCCTTAGGCAAGAAGAGACTAAAAGCTGAGAACTTGGAACTAAGTGACTTATGTGTCAGTGACAAGAAGAAGGATGTGTCTCCACTCTCAGCTTACGAGC

AAAAGCTTCAGACTGTACATGCCAGCAGTGATATGGAACAAGGGAAAATGGAGAAGTCCAGATCTTTAGAATGCAGATTGGATGGTGAATTGGCTATCAC

AAAGCCAAATGTATCCTCTCCTTCTAAACTTGGATATAACAGAGACACAGACTTCACGAAAAAACCATGTGCTTCTCTGAGGCAGATAGAGTCTGATCCA

GATGCAGACAAGAGCACTTTAAATCATGCAGACCACCCCAACAAAGCAGTTCAG CACCGAATGTTGTCCAGACAAGAGGAGCTGAAAGAAAGAGCGAGA

GTTCTGCTTGAGCAAGCAAGAAGAGATGCTGCTTTCAAGGTGGGGAGCAAGCATGGTGGCAGCGCAGCCCCTGCGCTCTGCAGCAGACAGCTAAATGAT 

CAGCAAGATGAAGAGAGACGTCGGCAGCTGAGAGAGAGGGCTCGTCAGCTAATAGCAGAAGCTCGATGCGGAGTGAAGATGTCAGAACTTCCCAGCTATG

GTGAAATGGCTGCAGAAAAGTTGAAAGAAAGGTCAAAGGCATCTGGAG ATGAAAATGATAATATTGAGATAGATACTAACGAAGAGATTCCTGAAGGCT

TTGTTGTAGGAGGTGGAGATGAACTTACTAATATAGAAAGTGACCTTGATAATCCCG AGCAGAATAGTAAGGTGGTGGACTTGAGGCTGAAGAAGCTAT

TAGAAGCCCAGCCACAGGTGGCAAACTTACTCCCCAGTGCTGCGCAGAAAGCTGTAACCGAGGCCTCCGAGCAAGGAGAAAAG AGTGGCGTGGAAGATC

TCCGGACTGAACGATTACAAAAAGCAACAGAACGTTTCAGAAATCCTGTTGTGTTTAACAAGGATTCCACAGTCAGAAAGACTCAGCTCCAGTCTTTCAG

TCAGTATGTTGAGAACAGACCAG AGATGAAAAGACAGAGATCAATACAGGAAGATACAAAGAGAGGAACTGAGGAGAAGGCAGAGATAACTGAAACTCA

GAGGAAGCCATCAGAAGATGAA AAAGGGTTCAAAGACACCAGTCAGTATGTTGTAGGGGAATTGGCAGCACTGGAGAATGAGCAGAAGCAAATTGACAC

CCGTGCCGCGCTGGTGGAGAAGCGCCTCCGCTATCTCATGGACACAG - UNI6709 - GAAGGAACACGGAAGAAGAGGAGGCGATGATGCAGGAATG

GTTCATGCTGGTTAATAAGAAAAATGCCTTAATAAGGAGGATGAACCAGCTTTCCCTCCT GGAAAAAGAGCATGACTTAGAACGAAGGTATGAGCTGCT

GAACCGGGAGCTACGGGCCATGCTAGCCATTGAAG ACTGGCAGAAGACCGAGGCCCAGAAGCGACGGGAACAGCTCCTGCTGGATGAACTAGTAGCCCT

GGTGGACAAGCGAGACGCCCTTGTCAGGGACCTGGACGCCCAGGAGAAGCA GGCCGAAGAAGAAGACGAGCATTTGGAGCGAACTCTGGAGCAAAACAA

AGGCAAGATGGCCAAGAAGGAGGAGAAGTGTGCTCTTCAGTAGTAGTAGCCTTGGACCAGACCTCTCCCCCACTACTTGAGTCTTAGGTCCCCAGGCCAG

AAGCAGACTGGTTGACTTAAAACTTTTTAACATTTTGTTTGCCTGGATTGTACTTCTGGACCCACCCCTCCCCCATTTCCTCTTCTCCAGATAATACACA

GAGCTCCAGATAGCTTTAAAGACTCTTTGAGTTAATCATGAAATCATTCTTGAAATCCTGTGAAGTAGATTTGCGCAGACACCCCGTGAATGACTGGTAC

TGAAGATGCTCAAGAAACTGTCCAAAAAGGAGGGAGACTCCCTGGTTATCGCCCCTTCTGTTTTGGATGGGATGAGAATCTGAAACATGTTTGTTGTAGT

ATTGTTGGTAATAGCGAAATGACAGTGGGTGGGGGGGCAAAGGGGAGTAAGAAAATGTCATGATTTTTTTTTCCAATCCCGCAGTATGTATGTGACACTG

TTACTTAAATCTCATAGTTAGATCTTAGTCTGTGTATTGACGAAGCTGTGTTCCATTTGCCAGTGGGATTTTCTGCAGTTGTTTACAATTCACATAAAGA

TAATAAAGTTCCTCTCTGCTCTCCTCAGAGGATGGCCCTGTAAGGTAGCCTGAGACAAACCTGGGGTTTGAAAGGTGACCTGGGAGAACAGCTCTGTTCA

ATGTGCAGCAGTTTACAAAGACAGCTCATCAGCTGATGATGCACCATCTTATACTCTGAATAATTATTTATTACATCTTGCTTGGTTCCTACTTTTTGTT

GGGGCTCAACATTGGCTCAAGAATGCTGTTAATATTTATTCTGTATTGATAAAAGTCTGTCTTGGCACTACAAGTAAATATCCCATTACATCTTCTCTAG

CATAGCACTGTGTGTTTTGTGAAAATGGTTATGTTTATTTATTACAATACTGAGTCATATATAAATTTTCAATAAAAGCAGAAACTTTCTTACCTT
Translation
SRTVPVSWPITMASVWKRLQRVGKHASKFQFVASYQELMVECTKKW - UNI29361 - WQPDKLVVVWTRRSRRKSSK - UNI22041 - AHSWQP

GIKNPYRGVVVWPVPENIEITVTLFK - UNI34331 - DPHAEEFEDKEWTFVIEN - UNI34331 - ESPSGRRKALATSSINMKQYASPMPTQT

DVKLKFKPLSKKVVSATLQFSLSCIFLREGKAT - UNI34331 - TDEDMQSLASLMSMKQADIGNLDDFEEDNEDDDENRVNQEEKAAKITE EIVN

QLNALSSLDEDQDDCIKQANVPSAKSASSSEE ELINTLNFLDEAQKDLATVNTNPFDEPDVTELNPFGDPDSEE EPITETTSPKKPEESFYNNSCNPF

KGVQTPQYLNPFDEPETFVMIKDSPPQSTRRKNLRPVDMSKYLYADSSKSEEELDE ESNPFYEPKPTSPNNLVNTVQEGETERRVKRRAPAPPAPLAPP

APPAPPALTPKTGVNENTVVSAGKDLSTSPK PSPIPSPVLGQKPNASQSLLAWCREVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLI IDYKSLN

PQDIKENNKK AYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQELNVVQIEENSSKSTYKVGNYETDTNSSVDQEKFYAELSDLKREP

EPHQPARGAVDLLSQDDSVFVTDSGVGESESEHQTPDDHLSPSTASPYYRRTKSDTEPQKSQQSSARTSGSDDPGLSSSTDSAQALASLGKKRLKAENLE

LSDLCVSDKKKDVSPLSAYEQKLQTVHASSDMEQGKMEKSRSLECRLDGELAITKPNVSSPSKLGYNRDTDFTKKPCASLRQIESDPDADKSTLNHADHP

NKAVQ HRMLSRQEELKERARVLLEQARRDAAFKVGSKHGGSAAPALCSRQLND QQDEERRRQLRERARQLIAEARCGVKMSELPSYGEMAAEKLKERS

KASGD DENDNIEIDTNEEIPEGFVVGGGDELTNIESDLDNPE EQNSKVVDLRLKKLLEAQPQVANLLPSAAQKAVTEASEQGEK SGVEDLRTERLQK

ATERFRNPVVFNKDSTVRKTQLQSFSQYVENRPE EMKRQRSIQEDTKRGTEEKAEITETQRKPSEDE KGFKDTSQYVVGELAALENEQKQIDTRAALV

EKRLRYLMDTG - UNI6709 - GRNTEEEEAMMQEWFMLVNKKNALIRRMNQLSLL LEKEHDLERRYELLNRELRAMLAIED DWQKTEAQKRREQL

LLDELVALVDKRDALVRDLDAQEKQ QAEEEDEHLERTLEQNKGKMAKKEEKCALQ

For any suggestions or comments, please send an email to unitrap@crg.es