Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042348 (Arl15)
Chromosomal location
Chr 13: 114584767 - 114947663 (+)
Description
ADP-ribosylation factor-like 15 Gene [Source:MGI Symbol;Acc:MGI:2442308]
RefSeq_dna
NM_172595 
RefSeq_peptide
NP_766183.1 
UniGene
Mm.79837 
MGI
MGI:2442308 
Uniprot/SWISSPROT
Q8BGR6 
Human Ortholog
ENSG00000185305 (ARL15)
Omim not available
UniTrap UNI518
Vector Insertion
Chr 13: 114584905 - 114712454
Public Clones CB0283 (sanger) CF0775 (sanger) AD0364 (sanger) AR0334 (sanger)
AM0263 (sanger) (sanger) CJ0494 (sanger) AC0487 (sanger) AT0578 (sanger)
AX0496 (sanger) CH0766 (sanger) AD0111 (sanger) AV0743 (sanger)
AL0759 (sanger) AZ0332 (sanger) AZ0174 (sanger) AD0363 (sanger)
AD0629 (sanger) CJ0348 (sanger) CH0758 (sanger) AF0334 (sanger)
AW0416 (sanger) CH0611 (sanger) AD0110 (sanger) AS1048 (sanger)
AR0554 (sanger) CJ0518 (sanger) AD0099 (sanger) CD0008 (sanger)
AX0497 (sanger) CJ0030 (sanger) XR0035 (sanger) AR0908 (sanger)
AN0298 (sanger) XL531 (baygenomics) RRT324 (baygenomics) RRO121 (baygenomics)
DTM013 (baygenomics) RRF211 (baygenomics) RRK299 (baygenomics) NPX233 (baygenomics)
RRO112 (baygenomics) P096D06 (ggtc) 5SE307E06 (ggtc) 3SD185F01 (ggtc)
D023D01 (ggtc) P007B06 (ggtc) 3SD078H11 (ggtc) 5SD105E05 (ggtc) P023D07 (ggtc)
W185D04 (ggtc) 3SE020G10 (ggtc) D054C02 (ggtc) Q022F08 (ggtc) 3SE307E06 (ggtc)
3SD150C11 (ggtc) D018B01 (ggtc) W244D06 (ggtc) 5SD054C02 (ggtc) 3SD105E05 (ggtc)
P026G10 (ggtc) 5SD185F01 (ggtc) P065D03 (ggtc) P015C04 (ggtc) 5SD078H11 (ggtc)
5SD119G07 (ggtc) P023D10 (ggtc) W272B03 (ggtc) 5SE043A04 (ggtc) 5SD088E09 (ggtc)
CMHD-GT_296A5-3 (cmhd) FHCRC-GT-S5-8A1 (fhcrc) Ayu21-T275 (egtc) IST14138F7 (tigm)
IST14501G3 (tigm) IST11388H10 (tigm) IST14578A4 (tigm) IST14582G2 (tigm)
IST13074H11 (tigm) IST14189D7 (tigm) IST12860G3 (tigm) IST14193D1 (tigm)
IST13638G11 (tigm) IST14375H2 (tigm) IST14190H10 (tigm) IST14667G7 (tigm)
IST14815A4 (tigm) IST14615H8 (tigm) IST11579A7 (tigm) IST14531A9 (tigm)
IST10465F6 (tigm) IST10831D1 (tigm) IST13631G5 (tigm) IST15101F2 (tigm)
IST14471F11 (tigm) IST14493F11 (tigm) IST10786D10 (tigm) IST14625D1 (tigm)
IST12182H11 (tigm) IST12109H11 (tigm) IST14477D3 (tigm) IST11526E1 (tigm)
IST14699G5 (tigm) IST14221A7 (tigm) IST10838D1 (tigm) IST14377C6 (tigm)
IST14299C1 (tigm) IST14974C4 (tigm) IST14340G5 (tigm) IST14654G8 (tigm)
IST15058C1 (tigm) IST14485H5 (tigm) IST14492B6 (tigm) IST11112H5 (tigm)
IST14871C11 (tigm) IST15109C11 (tigm) IST14388E1 (tigm) IST10057A1 (tigm)
Private Clones OST263035 (lexicon) OST226091 (lexicon) OST138309 (lexicon) OST43080 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12489
Vector Insertion
Chr 13: 114712600 - 114724271
Public Clones A023B02 (ggtc)
Private Clones OST223615 (lexicon) OST181850 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI239
Vector Insertion
Chr 13: 114724332 - 114757789
Public Clones GC0376 (tigem) XN886 (baygenomics) A041B03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI510
Vector Insertion
Chr 13: 114757999 - 114944911
Public Clones CH0164 (sanger) (sanger) CC0764 (sanger) XR0392 (sanger) CC0658 (sanger)
CC0763 (sanger) AB0187 (sanger) CJ0292 (sanger) CC0332 (sanger)
E033C10 (ggtc) 5SE314B11 (ggtc) 5SE287H08 (ggtc) 3SE314B11 (ggtc)
5SE314B12 (ggtc) CMHD-GT_361A5-3 (cmhd) IST12869E3 (tigm) IST13012D5 (tigm)
IST15053H4 (tigm) IST13985H9 (tigm) IST14510C11 (tigm) IST11349E11 (tigm)
IST14304G12 (tigm) IST11349A12 (tigm) IST10729H12 (tigm) IST14841B9 (tigm)
IST13094H9 (tigm) IST10881C6 (tigm) IST13716B12 (tigm) IST13081F8 (tigm)
IST13094H9HMF2 (tigm) IST11634F9 (tigm) IST13606D12 (tigm) IST10052C6 (tigm)
IST13061F12 (tigm) IST14781D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091201
Sequence
TTTCAGGAGCTGCTCGCTGGCAGCCCGAGACGCTGCTGCTTTTTTTTTTTTTCCGGGTTCGGAGCCATTCCGGATGCTTTAGGCTGCCGGATGTCTGATC

TCCGGATAACTGAGGCGTTTCTGTACATGGATTATCTG - UNI518 - TGTTTTCGAGCGCTTTGCTGCAAGGGACCACCACCTGCGCGCCCTGAATA

TGACTTGGTTTGCATAGGTCTCACGGGCTCCGGGAAAACCAGCCTGCTGTCCGAGCTCTGCAGCGAAAGCCCGGAGAACGTTGTGTCGACCACAG - UN

I12489 - GTTTTAGTATAAAGGCAGTGCCATTCCAGAATGCCGTTTTGAATGTAAAAGAACTTGGAG - UNI239 - GAGCTGACAATATCCGGAA

ATACTGGAGCCGCTACTACCAAGGATCTCAAGGGGTCATATTCGTATTAGACAGTGCCTCTTCAGAGGATGACTTAGAAACTGCTAGGAACGAACTGCAC

TCCGCTCTCCAGCACCCACAGCTATGCACTTTACCCTTTTTGATATTGGCCAATCATCAAGACAAGCCAGCAGCTCGCTCAGTACAAGAG - UNI510 

- ATCAAAAAGTATTTTGAACTTGAACCACTGGCCCGTGGAAAGCGCTGGATCCTGCAGCCCTGCTCTCTGGATGATGTGGACACACTGAAGGACAGCTT

CTCCCAGCTCATAAACTTGTTAGAAGAAAAAGACCACGAGGCAGTGAGAATGTGAGACCTGACACAGAAGTTCCGGGAAAGCCTCGAACCCGCCGTGTTC

GTTCCCCATCGTGATTCCATGTTGGTATCGAGACTGGCCCGGCTTCGGTATCTACTTGCCTCTAGCTATTTCAGACTTTCATCTCTCTGCTAACGTGACT

ATTCTGATAAGTCAGGTGGATTATCATCGGCATTAACGTCAAGTACACACTACTGAGAGAGAACTGATTCTCTGGTTACCACTAATTATCTTCACCGCAT

GTCTCTTCCTCCTGTTGGTCTAAGAATCTCTTCTCTGCTTTGTGCTAAAGTGGATGGAACTCACAGAAACGAGACCCGTTCTGAAGACCTCAGAAAGGCT

CATGTGGTTTCACTAACTTCTCTGGACTTGGGATCAGAAGATTCTGTCTGAGACTCCACACGATGGATACGCCATTGATATTTCCGTGATCTCTTAGGGG

TTGGAGGTTTTTTTTTTTTTACATTTTATTTTATCTCATCTGGTTTTCATATTGTTTTCTTGTGTGTGTGAGGATATTGACTTTGTAGGCTGAGTGAAAA

TGGCGGCCCAAAACTTCACCCAGTCATCTTCTCTGGCTCTGAAAAACTCTAGAAAGTAGACATGGAAGAATTGAAAAACTCTAGAAAGTAGACATGGAAG

AATTGAAAAACTCTAGAAAGTAGACATGGAAGAATTGCTTGGTCCTGCCTGCGGCCGTGTCCCCTGCCTTAGGAGGAGGGCATCCTAGCTAAGGGAGTGG

GAACCAGTTTAGGCAAGAACAGGCACCACTGATTTGAATCTGAACTCCTCAAATATTTTTAACGTCATTAGTCTGCATAAAACCGAGCTGCAACATACGC

ATCGGCCTTTCCTAGAAATCAGAAATGTTTGAATGAAATCTGGAAAATGGCTTTTCAAATAATTAACATAACAGCCAAAGTCTAATTCACGGTTAGGACT

TAAGCTGGCATGGGTTTGATGAAGCTCAAAGAGGAACCCCGTTATTTATTCATCAAAGGCTAATGTCACTTAGGGGAGTGTGCTCATTGAGTTGTTAAAG

GTCTGTCAGTACTTTTATTATAAACCTCTATTTTCAGGGGTGTCAATGTGCCCTTAGAGTATGCTGGGCTACAGCAGATAAATAAACTCAGTCTGAAACT

AATTTTTTTCCACTTAATTTAAATGATACAATTGCCTAGAGTAAAATGTACAGTTTTAGTAAGATTTAGCACCTTTGACCTTTTTGAAATCAGGACTAAT

CTATGAATATTCAGGTTCATAGATGAAATATTCTTTGGCATATCTTGTAGACACTTGACCACTCATTAAAATACTAAGTGGCCAAATGATAGAAAACTGC

TCCCTAAGCCCAAGCAATAAAAAAACCATGTCTGTCATTTTTAGGTAGTGTAGACTGATACCCCGATGCCACAGACTTAGGGCCATATTTATCACAGGGT

GACAGGAAACCTTGTGACTCTCCAGAGGAGAGTCCTCAGAACCCTGCACAGTGCTCAAATGCAGTATTTGTGATTTCATCTTGTAAATGGATTTTAATAA

AAAAGACCCCACACTTCTTTAAGCTTATATATATATACATATATATGTATGTATATATGTATATATATATATATATATATGGCATGGCCCAGAGAAGGAC

CCATGATAATTCATTTTGTCTAAAGTATCCTTGAATATTTTTAAAACTGTGACGATCCACAGGCAGCACAAACCTTTAATCCACATGAGCAGTTAAACGA

TTCCTGTTTTTATTTTGTCCCTCCCGTGCTCATCTTCCATGAAAATAAATAAATGAATGATTTTTTTTTTCCGGGCTTTGCTCTCCCTGCAAGTTCATTA

AATGCAGAATGTTGTCTTTTGAGGATCTTGTGGCCGAACGCTCCTTGCCATCTGTTAAATGACTTCCCGTTGTCTGTGTGTGTTCATGTGCGCCAGTGAT

GGGCTTCTCCACAGCCCCCGAGACTGTCTGAGGCGTCGCAGCCGTCAGAATGAAAACATTATCAATCAGTACCCAACAACAGCTGTTTTTGACAAGTTTC

TGTCTGACGCCTGATGCTTTACAACTGTCAATAAGGCTCTTTCTTTGTCTAGCAGGTCGCAGCTCGCTGTCTTACTGCTTCTTCTTGGCATCCTGGACTC

TGTAACCCTAGAATTTACTGTGTTTGGGAAACCCAGGTGGGGGAGGGGAGGGGGGAAAGGGGAGGGGACATTCGTCTTGTTCTTACTTTTGTGTGAGGTG

CCACAGGTGTCTTGGTTTGCATATTCAAAGATATAGGAAAACAGTCTGTTGTGTATTTCCTCAGTGAGCATCTTGTTATATTTATGGAAGTGACCCATTT

TTGTACCTTCTTAGCTAAAGCGGTTGCCTCTTTTTATACTGGCAATTAATTTATATAAGACTTTGTATCTACCATAGTTTACAGTATTGGTTGCTGGATA

ACTGCCATATCGCCCTGTCTTTCTATGGAGATTTACTCTATCCAGACTTAAAAGTTGACAGGCTCACATGGGCATTTGCTAGGCAACAAGAACTTGCCCT

ATTCACAATTTATATGATTTCCACTGTCTTGCAATGAAAATAAATGCTGAGTAG
Translation
MSDLRITEAFLYMDYL - UNI518 - CFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSELCSESPENVVSTTG - UNI12489 - GFSIKAVPF

QNAVLNVKELGG - UNI239 - GADNIRKYWSRYYQGSQGVIFVLDSASSEDDLETARNELHSALQHPQLCTLPFLILANHQDKPAARSVQE - UNI

510 - IKKYFELEPLARGKRWILQPCSLDDVDTLKDSFSQLINLLEEKDHEAVRM

For any suggestions or comments, please send an email to unitrap@crg.es