Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042359 (Osbpl6)
Chromosomal location
Chr 2: 76244595 - 76438704 (+)
Description
oxysterol binding protein-like 6 Gene [Source:MGI (curated);Acc:Osbpl6-001]
RefSeq_dna
NM_145525 
RefSeq_peptide
NP_663500.2 
UniGene
Mm.240435 Mm.408084 
MGI
MGI:2139014 
Uniprot/SWISSPROT
Q8BXR9 
Uniprot/SPTREMBL
Q5DTM2 Q8BXC3 A2ATI0 A2ATH9 Q8R1X8 
Human Ortholog
ENSG00000079156 (OSBPL6)
Omim not available
UniTrap UNI34501
Vector Insertion
Chr 2: 76244747 - 76337313
Public Clones IST10196G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36682
Vector Insertion
Chr 2: 76337480 - 76351973
Public Clones IST14149E4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077972
Sequence
GGAGGCGCCGCGCGGCCGCCGCTGTCCGCGCTGGAGACCACAGCTCGGCACAGGCGGCGCCCGTCCTCCGCGCCTCCGGAGCCTCCTCCAGCCTGCGCGC

CGGGCAGATAGCACGGGCCATCTCCCACCGCGACCTACCGCTCGCCCTGCAG - UNI34501 - GTTCTTGCTGGGAAACCAACAAAAGAAGACAGTT

AAGGCACCAGCAGTGCCAACAGGGCTGGCAGACCGCAGAGGAGCAAGACGAGCTAAAGGCATCCAAAGCCAGTCCACTGAGAAGCAGTTGTAATGGTGCA

GCCAAGCTAGAAGACTTTGACACAAGCCGAAG - UNI36682 - GTGGTTTGGACTCGTCAGCAGTGGCCTGAGTTTTCCTAGTCCAGTCTGATCCGA

GGGAGATGGACTAAAGCCACAGATTGTCTGCTTCTCTGTCTGTGAATTGCAAGGAGGATTGGGATGGTCTTCCGTGCACATCCCTAGACTAATTGCAGCA

ATGAGTTCAGACGAGAAGGGCATATCCCCTGCTCATAAAACATCCACTCCGACCCATAGAAGTGCCTCGTCTTCAACATCTTCTCAGAGGGAAAGCAGAC

AG AGCATCCACGTTTTGGAGAGAACTGCTTCATCCAGCACGGAGCCCTCTGTCAGTCGGCAGTTGCTAGAGCCGGAGCCCATCCCCCTCTCCAAG GAA

GCTGACAGCTGGGAAATTATAGAAGGGCTGAAAATAGGCCAAACCAATGTCCAGAAACCAGACAGGCACGAGGGATTTATGCTGAAGAAAAGAAAATGGC

CTTTAAAGGGCTGGCACAAG CGCTTTTTTGTCCTGGATAATGGAATGCTGAAGTATTCCAAGGCGCCACTTGAT ATCCAAAAAGGAAAAGTGCACGGG

AGCATAGATGTCGGACTGTCTGTCATGTCGATTAAAAAGAAAGCTCGGAGGATAGACCTTGACACGGAAGAGCACATCTATCATTTGAAG GTGAAATCC

CAGGACTGGTTTGACGCTTGGGTCTCCAAACTGCGCCATCACAGGTTGTACCGTCAGAATGAAATTGTGAGGTCGCCGAGAGATGCCAGTTTCCACATAT

TTCCTGCAACTTCGACAGCTGAGTCCTCCCCGGCTGCTAATGTCTCTGTTGTGGATGGAAAG ATGCAGCCCAACAGCTTTCCATGGCAGTCGCCATTAC

CATGCAGTAACAGCCTCCCTGCGACCTGCACAACTGGGCAGAGTAAAGTGGCAGCCTGGCTGCAGGACTCAGAAGAAATGGACAGGTGTGCAGAAG ATC

TTGCACACTGCCAGTCAAACCTTGTGGAACTTAGCAAGCTCCTGCAAAACTTGGAGATCCTTCAGAGAACTCAGTCGGCGCCTAACTTCACTGACATGCA

G GCTAACTGTGTAGATATTTCAAAGAAAGACAAGCGGGTCACAAGACGCTGGAGGACAAAAAGTGTCAGCAAAGATACAAAAATACAGCTCCAG GAAG

GGCCACCTGCGAAGGGCCAGTTCAACACAACTCGGCGCCGGCAGAGGCTAGCGGCAGCAGTGGCTACAACA GTTCCTTTCAGCGCCACCATGTCACCCG

TGCGTCTGCACTCCTCCAACCCCAACCTTTGTGCAGACATTGAGTTCCAGACCCCTCCTAGCCACCTCACCGACCCTCTGGAAAGTTCCACGGATTATAC

CAAGCTACAAGAAGAATTTTGTCTAATTGCACAGAAAG TGCATTCTCTTCTGAAGTCTGCATTTAACAGCATAGCTATAGAGAAGGAGAAGCTGAAGCA

GGTGGTCTCGGAGCAAGATCACAACAAAGGCCACAGCACACAGATGGCCAGACTCCGGCAGTCACTGTCACAG AGTGAAGGAGCCGGCAAATCCTGG G

CACTTAACCAGAACGCTGAGCTCCGGAGTCGGCTGAACAGAATACACTCAGAGTCTACCATTTGTGATCACGTTGTCAGTGTAAATATTATCCCTAGCCC

CGATGAG CCTGGTGAGCAAATCCATGTCAGCCTCCCTCTGTCACAGCAGGTGGCCAACGAGAGCCGCCTCTCCATGTCAGAATCCGTGTCAGAATTCTT

CGATGCCCAAGAGGTGCTCCTGTCTGCAAGCTCATCAGAGAATGAG GCTTCTGATGATGAGTCCTACATCAGCGACGTGAGTGACAACATATCTGAGGA

CAACACCAGTGTCGCCGACAACATTTCTCGGCAAA TCCTGAATGGGGAGCTCACAGGAGGCGCCTTCCGCAATGGCCGTCGCACCTGCCTGCCTGCTCC

TTGCCCGGACACCAGTAACATTAACCTGTGGAATATCTTGAGGAACAACATTGGCAAAGACCTGTCGAAGGTCTCCATGCCCGTGGAACTCAACGAGCCC

CTCAACACCCTGCAGCACCTCTGTGAGGAAATGGAATACAGTGAGCTCCTGGACAAGGCCTCAGAGACCGACGACCCCTACGAGAGGATG GTTCTCGTC

GCTGCCTTTGCAGTCTCAGGGTACTGTTCCACCTACTTCCGAGCAGGAAGCAAGCCATTCAATCCGGTCCTGGGGGAGACCTATGAATGCATAAGAGAAG

ATAAGGGGTTTCGGTTCTTCTCAGAACAA GTTAGCCATCATCCACCCATTTCTGCCTGTCACTGTGAATCCAAGAATTTTGTGTTTTGGCAAG ATATC

AGATGGAAAAATAAGTTCTGGGGAAAGTCCATGGAAATCCTGCCTGTCGGAACCCTGAACGTCACGCTTCCAAA ATATGGGGATTACTATGTGTGGAAT

AAAGTCACCACGTGCATACACAATATCCTGAGTGGGAGGAGATGGATCGAGCACTACGGTGAAGTGACCCTTAGAAATACCAAAAGCAGTGTTTGCATTT

GCAAACTCACGTTTGTCAAG GTGAATTACTGGAACTCCAACGTGAATGAAGTCCAGGGGGTGGTGATAGACCAGGAGGGGAAGGTGGTGCACCGGCTGT

TTGGGAAATGGCACGAAGGACTCTACTGCGGGGTGGCCCCCTCGGCAAAGTGCATCTGGAGACCAG GTTCTCTGCCAACCAACTATGAGCTCTACTATG

GCTTTACAAGATTTGCTGTGGAGCTCAATGAGTTGGACCCCGTCCTGAAGGACCTCCTTCCCCCCACAGATGCCCGATTCCGGCCAGATCAAAG GTTTT

TGGAAGAAGGGAACCTAGAAGCCGCAGCCGCAGAGAAACAAAGAGTTGAGGAACTCCAAAGATCGCGAAGACGCTACATGGAGGAAAACAACCTTGAACA

TATACCAAAATTTTTTAA AAAAGTTATTGATGCAAATCAAAGAGAAGCCTGGGTTTCTAACGACACCTACTGGGAGCTTCGAAAGGACCCTGGGTTTAG

CAAAGTAGACAGCCCCGTTCTTTGGTAAACTGGAGACATAGAGCTAGCCAATATCCCACACTCGGAATGAATAAATAACTATGCACAATTATGTTTCTTA

TAGCTACGCGTGGTTTCTGGGTCGACTGAAAAGCTCCCATTGGCTTTTCTATTCATCTTTATAATGGATTTTCAAAAGTGCATTAGACAAGGCTCCTAAC

CACTTTTGGATCCTTTCTGTTTTGCTGCAACCATATTCCTTAAATAAATAAATAAATAAATAAATAAAACCCATGCCCTCCTCGGAAAGCAGCCTAAAAG

AAGGAGAATATAAAATCCAAAGTCGGGAGAGTCAGAAAAGAAGATGAAACTGTAACAGGCGCTTCAAGCTGATCAGGAGAGTTTTAAATGATGTACAAAC

TACACGTTCCGTCTGCTGTCTGAAAGCGTCATCCCATACCTTAGGAGCTCCGGGGCCGTAGTCGGTTAGTTCAGACTTGAAGTGTGTTCTTTTGATGTGG

TGTGCTTGTTCTCAGCCTCGTGAAAATCGACAACGCGATGCTTCCCGAAACCCACTCCATCTTTACGACATTGTTCATGCCTTAAGAAATGCAAAGATGT

ACAATAAACTGTTTTCTAAATGTGTGCTCATAGGTGTATGTGAAGGACAGAGTGCTGGCGTGATTCACTTTCTTGGTCAGAAGGTTGATTCAGCTGATAG

AAGGATTAAATGAGGGAAAAACACACTTTCCTTTGCTAAGTCAGTTCTGCTGTGGTGGATCTGAGGGGCAAGAGGGCTAAGGTACTGTATCCTAAGTTAG

ATCTCTGTATCCAGGTCGTTCTTTAAGTTCCTGTCCTATGTCCAGATAGTAAGCCATCCCTCCTCCGTCTGACCTCACAGTGTGCCCTGGTATTTGGCAA

AAGTTGTATCTGATTTGGACGCCCGTCATCAGTGTTAAACTTCAGTAGGAAGTAACAAAGCCCAGTTTCTGCCTGGGCTGGGTGGTACCACAAAGCACAC

AGGCCATAGAACACATCCCTGGCTCATGCCCGCCACTCGACACTGTTGCGATTCCATGGAGAACGAAAGCTTATTTGCATTATGTAAATGGATCCTATGC

ATAATCATGTTTCTTTTTTAAAAAAAATCAAGCGGTTCCATATGATACACGGTTACATATTAAGCATCTACCTTGCTAAGGGCAGATATATAAAACTTAG

GCTTAAAAAAAAGTAATCCATTCCAAAGGTGGGGTCAGGCAAGGTTTGATTTCAATCCTTGAGGTTTTGTTTTTCCTCCACGGGTACACAGAGGCTTTTG

TAGGAAGCTTGCATTGGCGTTTTTAAGTTCTTGCATGTACATGACAATATAAACACCCGTATGTTTTTTAAAAAAAAATCTCTTAAGGGGGCTTCCTAGA

GAATTAGAAACTTATATATATTTTATTGTTAGAGTTTTATTCTTAGATTCTTACCATCTGAATTTAAGTGTTACTTTAGACTCTGATAACAAGGTTAGTG

ACATTTTATATTTTGTTAAGAGGTATCTATCAATCTCGGTGTTATTTCTCCCCCCTCCCCGCCCCCGCAAAGTATTCCTAATAATGGCTAACTCACCATA

AAACCCAAACCTTTTGTGAACATGGAGGGAAATCCAGAGTTTCCCCTAGATGGAGCAATATTTTAGTTATCCCCAAATTCATCTCCCCATTCATGTACAC

CATGCACACAGCTGTTAGTCATTCGAATGAAACTTCGCTCTCCAAAGAGTTCCCGAAGTCAGAGCCAGAGCCAGGCTTCCGCTTACACGGCTTTCTCCAT

GTGCTCCTGAGTCCTAGGTGACTCGCCCTGCAGTTGCAAAACCTTCCCCCGTGTCACGGACTACTTTTTTTCTCGGTTCAACCCGATGCTGTTTTATCAG

TGCATCTCTAGTTATGTCTGATTTTATATTGAGTTAGGACTTAATTACAGTCCCGTGGACCTCCTCATAAAAGCTGGTTCTCCTCCAACTGAGAAAGCTT

ACAGTACAATTTAAAGTGGGTCTCGCCTGCACTTACTAGTGTCTGACGAAACAGTCTTACATCTGCCTAAGTAATAGAAGAGCCCTGCAGAATAGAGATG

CCACAAGGAGGGACTGCGAAGGTGAGGTGATCAAAACACAATAGGAGATGTCCATTTAGTAAAGGACAGAAGGCCCAGGACACAGCAGGGAAGTAAAGAC

AGCTCCCAGGTTTGGATTAACTGAGAAGAAAGGAGAAACAACAGATGAAGCCTTTGTAGTCAGATAGTAAGGTTAAGATGACAAATAAGATAAGGTCAGA

TCTACCCGGAAACTCTAATAAGAATTTCAGGATGCAAACGAGAGAAGCATGGGATTAATTACAATCACATTGTATGGCATCCTCCATTTTGAATCTGTTT

GGAGATTTTGGTTCCCCCGGGTGTGACCATTATGTTGTCAGGTCTCGTCTCAATCACGTCATCAGTTAGGCTTCAAATTCCCCCACCCCCACCCCAGCAC

CCGACTCACCCATCTCCAATGGAACACTCACTTGTCTTGCTGAAATGGCCTTGTCCTTTTTGTTCACACAGTGATTATAAAGAACTCTATTGAAATTTCA

TTTACATGACATTTCAGCTATTAAACCTAAATGACAAGAGGGTGGAGTGGTATAGCTTATTCTCTTGATAAAAAATGTGATGTAGCCCTTGGAATTTTAC

ATAAACCACTATATTTGGGAGATAGTGGTTTTCTGTCAAAGGGCCGTAGGAAGGCTTAGTATGCCTGTGTTCTTTTCCATGCTTTATTTTCAAAGCTCCC

TCCCCTCTGGCAAAATTGTCCTGAGAGTGACAGTGACCCTGAGGGGTTTGCCAGACTGGGCTGACTGGTCAGTACCAACCTTTGCTGAGGCTCACCAAAA

TTGGATCATTTTGATGCTGAATGCTGTTAACCAAGGTGTAAATGTACTCTTCAGTGTTGCTGATCTTTCTTATTTTTTAATTGTCATTATTTTTCTTGGG

TTATTTTAAAATGATGTCCATGTTCTCTCCAGGTAGCTGTAAAAAATAAATAAAATAAACTTCATTTAAGATACCTGTTAGTGCTACATGTCAGTTGTAT

GTGATTGCAGGGTCAAATGTCATTCTTCTGCCTGAGGGAAACCAAGGAAATTGTGGTACAGAGGCCACCAACTTGTCAACTTCCCAAATCTTTTGTGCTC

AAGCTCTTGATTCTTCTGGCCTTGTGTTATTCTGCATTAGCACTTACCAGTCATTAGATCCTGTTCTAATGGACTAGCATGGAGCTCAGAGAGGGAGAGA

CGCTCTAGGAAGGAAACCCTGATTAACGTGTTTAGTTTAGTAGTAAAGAACATTTTTTGTTACTCTTCTGTGGGTTTAATTATCCATCCTGTTTAATGCT

GTTCTCTGTCATCCTAGAAAATAAAGCGTTTGTGGGAGCAGAGCTCCGCCCAGCAGGGGGCAGAGCAGATGTTTGCACTTGGCTCAGTATGTTATGAATG

TGGCACAGTAAATAAAGTTTGTGTACAGAATATTAGTTTATTTCTATGAGAGCAATTATGTTCAGGATATATAAAAAATGTATCTAATTAAACCATTACG

GATCTATTTTGTGCTCTAGAAATGTTCTTTTTTTTGGGTTGGGGGGAGTGTCTATAGAGCTAAAAGTAAAATGTTGATGTGTTCTCATGGGTTTGGTTTC

GTCTCCCAAATGCTCCGTGGCTTTTGGGAAAGACTCCATATCACCCCAGGAATCTATCTTAATTGAGTTTGGTTTGTAAACACTTCTACTTTGAAAGTTG

TGCATTGTGTGGCTCCTTCTCTGAAACAGAAACTAGCTTTATTAACAACATCTTCAGTACCTCTTCTGCCTGTCACGGAGATGTGGAACCTTTCTGCAGT

GGCCGCTTTCAAAAAGAGAATGGCAAATTGCATTGGATGGGTTTGGCTTCATTCTTCTAACCTGGGATCTAAAGGATGGATAAATGCTGTGATGAAGTAA

CATGCCCTACATCCTAAGTAGATCAGGCCCTTAGGACAGACAGACAGACAGACAGACAGACAGACATCTGGCAGATGCCTCGTCTGGAAGAGAATTGGTG

TTGTACTCTTGCATTGGCTTTTCAAAACAACAAGCTTGTCTCTCTATCCTCTGGTCCTTACAAGCAGAAGGGGAGATGCTGCTGGGTACCATGTCATTGT

CTGTGAAATGGGCTGTCTTCATGTGTAATCTCAGTCATTCGGTATTAGAAACTGCTTCATTCATTTTCCTCATGAACAGTATTAATTCTTCATGAGTTAA

AAGGTTCCTTATATACACATATTATGAGTTATTTTCCAAACTGATAGAAAAAAAAAAGTTAACCAAAAGTTCTCAGTTTCCATAAATTTTGTTTCTATCT

GTACCTTCCTTTCCAAAATGAGTTAATTGTAAAGAAAAGGATATTAAATTTTTGGTAAAATAAAGTGGAATCCTGTGTGGGGTCCGTCTGCTTCTTCTCT

CAGCATTAGATCAGATGAGGAAGGGAACTGAACTCTTAGACAGGACGATGATAAAATCACTGCTCCCTTACATGTCTGCTCTCCCTCAGTGTTTCATCTC

AGGCCTTCGGGAACTAAAATGTTTGCTGTGCTTTTTAAAAAGCTGGATAAAAATGTTATATAATAAATGTCACACGTTGAAACTGATAC
Translation
 - UNI34501 -  - UNI36682 - MSSDEKGISPAHKTSTPTHRSASSSTSSQRESRQ SIHVLERTASSSTEPSVSRQLLEPEPIPLSK EADSW

EIIEGLKIGQTNVQKPDRHEGFMLKKRKWPLKGWHK RFFVLDNGMLKYSKAPLD IQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLK VKSQD

WFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPATSTAESSPAANVSVVDGK MQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAED D

LAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQ ANCVDISKKDKRVTRRWRTKSVSKDTKIQLQ EGPPAKGQFNTTRRRQRLAAAVATT VPFSATM

SPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKV VHSLLKSAFNSIAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQ SEGA

GKSW ALNQNAELRSRLNRIHSESTICDHVVSVNIIPSPDE PGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENE ASDDESYISDV

SDNISEDNTSVADNISRQI ILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDD

PYERM VLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQ VSHHPPISACHCESKNFVFWQD DIRWKNKFWGKSMEILPVGTLNVT

LPK KYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTLRNTKSSVCICKLTFVK VNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIW

RPG GSLPTNYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQR RFLEEGNLEAAAAEKQRVEELQRSRRRYMEENNLEHIPKFFK KKVIDANQR

EAWVSNDTYWELRKDPGFSKVDSPVLW
Transcript ENSMUST00000090784
Sequence
GGAGGCGCCGCGCGGCCGCCGCTGTCCGCGCTGGAGACCACAGCTCGGCACAGGCGGCGCCCGTCCTCCGCGCCTCCGGAGCCTCCTCCAGCCTGCGCGC

CGGGCAGATAGCACGGGCCATCTCCCACCGCGACCTACCGCTCGCCCTGCAG - UNI34501 - GTTCTTGCTGGGAAACCAACAAAAGAAGACAGTT

AAGGCACCAGCAGTGCCAACAGGGCTGGCAGACCGCAGAGGAGCAAGACGAGCTAAAGGCATCCAAAGCCAGTCCACTGAGAAGCAGTTGTAATGGTGCA

GCCAAGCTAGAAGACTTTGACACAAGCCGAAG - UNI36682 - GTGGTTTGGACTCGTCAGCAGTGGCCTGAGTTTTCCTAGTCCAGTCTGATCCGA

GGGAGATGGACTAAAGCCACAGATTGTCTGCTTCTCTGTCTGTGAATTGCAAGGAGGATTGGGATGGTCTTCCGTGCACATCCCTAGACTAATTGCAGCA

ATGAGTTCAGACGAGAAGGGCATATCCCCTGCTCATAAAACATCCACTCCGACCCATAGAAGTGCCTCGTCTTCAACATCTTCTCAGAGGGAAAGCAGAC

AG AGCATCCACGTTTTGGAGAGAACTGCTTCATCCAGCACGGAGCCCTCTGTCAGTCGGCAGTTGCTAGAGCCGGAGCCCATCCCCCTCTCCAAG GAA

GCTGACAGCTGGGAAATTATAGAAGGGCTGAAAATAGGCCAAACCAATGTCCAGAAACCAGACAGGCACGAGGGATTTATGCTGAAGAAAAGAAAATGGC

CTTTAAAGGGCTGGCACAAG CGCTTTTTTGTCCTGGATAATGGAATGCTGAAGTATTCCAAGGCGCCACTTGAT ATCCAAAAAGGAAAAGTGCACGGG

AGCATAGATGTCGGACTGTCTGTCATGTCGATTAAAAAGAAAGCTCGGAGGATAGACCTTGACACGGAAGAGCACATCTATCATTTGAAG GTGAAATCC

CAGGACTGGTTTGACGCTTGGGTCTCCAAACTGCGCCATCACAGGTTGTACCGTCAGAATGAAATTGTGAGGTCGCCGAGAGATGCCAGTTTCCACATAT

TTCCTGCAACTTCGACAGCTGAGTCCTCCCCGGCTGCTAATGTCTCTGTTGTGGATGGAAAG ATGCAGCCCAACAGCTTTCCATGGCAGTCGCCATTAC

CATGCAGTAACAGCCTCCCTGCGACCTGCACAACTGGGCAGAGTAAAGTGGCAGCCTGGCTGCAGGACTCAGAAGAAATGGACAGGTGTGCAGAAG ATC

TTGCACACTGCCAGTCAAACCTTGTGGAACTTAGCAAGCTCCTGCAAAACTTGGAGATCCTTCAGAGAACTCAGTCGGCGCCTAACTTCACTGACATGCA

G GCTAACTGTGTAGATATTTCAAAGAAAGACAAGCGGGTCACAAGACGCTGGAGGACAAAAAGTGTCAGCAAAGATACAAAAATACAGCTCCAG GAAG

GGCCACCTGCGAAGGGCCAGTTCAACACAACTCGGCGCCGGCAGAGGCTAGCGGCAGCAGTGGCTACAACA GTTCCTTTCAGCGCCACCATGTCACCCG

TGCGTCTGCACTCCTCCAACCCCAACCTTTGTGCAGACATTGAGTTCCAGACCCCTCCTAGCCACCTCACCGACCCTCTGGAAAGTTCCACGGATTATAC

CAAGCTACAAGAAGAATTTTGTCTAATTGCACAGAAAG TGCATTCTCTTCTGAAGTCTGCATTTAACAGCATAGCTATAGAGAAGGAGAAGCTGAAGCA

GGTGGTCTCGGAGCAAGATCACAACAAAGGCCACAGCACACAGATGGCCAGACTCCGGCAGTCACTGTCACAG GCACTTAACCAGAACGCTGAGCTCCG

GAGTCGGCTGAACAGAATACACTCAGAGTCTACCATTTGTGATCACGTTGTCAGTGTAAATATTATCCCTAGCCCCGATGAG CCTGGTGAGCAAATCCA

TGTCAGCCTCCCTCTGTCACAGCAGGTGGCCAACGAGAGCCGCCTCTCCATGTCAGAATCCGTGTCAGAATTCTTCGATGCCCAAGAGGTGCTCCTGTCT

GCAAGCTCATCAGAGAATGAG GCTTCTGATGATGAGTCCTACATCAGCGACGTGAGTGACAACATATCTGAGGACAACACCAGTGTCGCCGACAACATT

TCTCGGCAAA TCCTGAATGGGGAGCTCACAGGAGGCGCCTTCCGCAATGGCCGTCGCACCTGCCTGCCTGCTCCTTGCCCGGACACCAGTAACATTAAC

CTGTGGAATATCTTGAGGAACAACATTGGCAAAGACCTGTCGAAGGTCTCCATGCCCGTGGAACTCAACGAGCCCCTCAACACCCTGCAGCACCTCTGTG

AGGAAATGGAATACAGTGAGCTCCTGGACAAGGCCTCAGAGACCGACGACCCCTACGAGAGGATG GTTCTCGTCGCTGCCTTTGCAGTCTCAGGGTACT

GTTCCACCTACTTCCGAGCAGGAAGCAAGCCATTCAATCCGGTCCTGGGGGAGACCTATGAATGCATAAGAGAAGATAAGGGGTTTCGGTTCTTCTCAGA

ACAA GTTAGCCATCATCCACCCATTTCTGCCTGTCACTGTGAATCCAAGAATTTTGTGTTTTGGCAAG ATATCAGATGGAAAAATAAGTTCTGGGGAA

AGTCCATGGAAATCCTGCCTGTCGGAACCCTGAACGTCACGCTTCCAAA ATATGGGGATTACTATGTGTGGAATAAAGTCACCACGTGCATACACAATA

TCCTGAGTGGGAGGAGATGGATCGAGCACTACGGTGAAGTGACCCTTAGAAATACCAAAAGCAGTGTTTGCATTTGCAAACTCACGTTTGTCAAG GTGA

ATTACTGGAACTCCAACGTGAATGAAGTCCAGGGGGTGGTGATAGACCAGGAGGGGAAGGTGGTGCACCGGCTGTTTGGGAAATGGCACGAAGGACTCTA

CTGCGGGGTGGCCCCCTCGGCAAAGTGCATCTGGAGACCAG GTTCTCTGCCAACCAACTATGAGCTCTACTATGGCTTTACAAGATTTGCTGTGGAGCT

CAATGAGTTGGACCCCGTCCTGAAGGACCTCCTTCCCCCCACAGATGCCCGATTCCGGCCAGATCAAAG GTTTTTGGAAGAAGGGAACCTAGAAGCCGC

AGCCGCAGAGAAACAAAGAGTTGAGGAACTCCAAAGATCGCGAAGACGCTACATGGAGGAAAACAACCTTGAACATATACCAAAATTTTTTAA AAAAGT

TATTGATGCAAATCAAAGAGAAGCCTGGGTTTCTAACGACACCTACTGGGAGCTTCGAAAGGACCCTGGGTTTAGCAAAGTAGACAGCCCCGTTCTTTGG

TAAACTGGAGACATAGAGCTAGCCAATATCCCACACTCGGAATGAATAAATAACTATGCACAATTATGTTTCTTATAGCTACGCGTGGTTTCTGGGTCGA

CTGAAAAGCTCCCATTGGCTTTTCTATTCATCTTTATAATGGATTTTCAAAAGTGCATTAGACAAGGCTCCTAACCACTTTTGGATCCTTTCTGTTTTGC

TGCAACCATATTCCTTAAATAAATAAATAAATAAATAAATAAAACCCATGCCCTCCTCGGAAAGCAGCCTAAAAGAAGGAGAATATAAAATCCAAAGTCG

GGAGAGTCAGAAAAGAAGATGAAACTGTAACAGGCGCTTCAAGCTGATCAGGAGAGTTTTAAATGATGTACAAACTACACGTTCCGTCTGCTGTCTGAAA

GCGTCATCCCATACCTTAGGAGCTCCGGGGCCGTAGTCGGTTAGTTCAGACTTGAAGTGTGTTCTTTTGATGTGGTGTGCTTGTTCTCAGCCTCGTGAAA

ATCGACAACGCGATGCTTCCCGAAACCCACTCCATCTTTACGACATTGTTCATGCCTTAAGAAATGCAAAGATGTACAATAAACTGTTTTCTAAATGTGT

GCTCATAGGTGTATGTGAAGGACAGAGTGCTGGCGTGATTCACTTTCTTGGTCAGAAGGTTGATTCAGCTGATAGAAGGATTAAATGAGGGAAAAACACA

CTTTCCTTTGCTAAGTCAGTTCTGCTGTGGTGGATCTGAGGGGCAAGAGGGCTAAGGTACTGTATCCTAAGTTAGATCTCTGTATCCAGGTCGTTCTTTA

AGTTCCTGTCCTATGTCCAGATAGTAAGCCATCCCTCCTCCGTCTGACCTCACAGTGTGCCCTGGTATTTGGCAAAAGTTGTATCTGATTTGGACGCCCG

TCATCAGTGTTAAACTTCAGTAGGAAGTAACAAAGCCCAGTTTCTGCCTGGGCTGGGTGGTACCACAAAGCACACAGGCCATAGAACACATCCCTGGCTC

ATGCCCGCCACTCGACACTGTTGCGATTCCATGGAGAACGAAAGCTTATTTGCATTATGTAAATGGATCCTATGCATAATCATGTTTCTTTTTTAAAAAA

AATCAAGCGGTTCCATATGATACACGGTTACATATTAAGCATCTACCTTGCTAAGGGCAGATATATAAAACTTAGGCTTAAAAAAAAGTAATCCATTCCA

AAGGTGGGGTCAGGCAAGGTTTGATTTCAATCCTTGAGGTTTTGTTTTTCCTCCACGGGTACACAGAGGCTTTTGTAGGAAGCTTGCATTGGCGTTTTTA

AGTTCTTGCATGTACATGACAATATAAACACCCGTATGTTTTTTAAAAAAAAATCTCTTAAGGGGGCTTCCTAGAGAATTAGAAACTTATATATATTTTA

TTGTTAGAGTTTTATTCTTAGATTCTTACCATCTGAATTTAAGTGTTACTTTAGACTCTGATAACAAGGTTAGTGACATTTTATATTTTGTTAAGAGGTA

TCTATCAATCTCGGTGTTATTTCTCCCCCCTCCCCGCCCCCGCAAAGTATTCCTAATAATGGCTAACTCACCATAAAACCCAAACCTTTTGTGAACATGG

AGGGAAATCCAGAGTTTCCCCTAGATGGAGCAATATTTTAGTTATCCCCAAATTCATCTCCCCATTCATGTACACCATGCACACAGCTGTTAGTCATTCG

AATGAAACTTCGCTCTCCAAAGAGTTCCCGAAGTCAGAGCCAGAGCCAGGCTTCCGCTTACACGGCTTTCTCCATGTGCTCCTGAGTCCTAGGTGACTCG

CCCTGCAGTTGCAAAACCTTCCCCCGTGTCACGGACTACTTTTTTTCTCGGTTCAACCCGATGCTGTTTTATCAGTGCATCTCTAGTTATGTCTGATTTT

ATATTGAGTTAGGACTTAATTACAGTCCCGTGGACCTCCTCATAAAAGCTGGTTCTCCTCCAACTGAGAAAGCTTACAGTACAATTTAAAGTGGGTCTCG

CCTGCACTTACTAGTGTCTGACGAAACAGTCTTACATCTGCCTAAGTAATAGAAGAGCCCTGCAGAATAGAGATGCCACAAGGAGGGACTGCGAAGGTGA

GGTGATCAAAACACAATAGGAGATGTCCATTTAGTAAAGGACAGAAGGCCCAGGACACAGCAGGGAAGTAAAGACAGCTCCCAGGTTTGGATTAACTGAG

AAGAAAGGAGAAACAACAGATGAAGCCTTTGTAGTCAGATAGTAAGGTTAAGATGACAAATAAGATAAGGTCAGATCTACCCGGAAACTCTAATAAGAAT

TTCAGGATGCAAACGAGAGAAGCATGGGATTAATTACAATCACATTGTATGGCATCCTCCATTTTGAATCTGTTTGGAGATTTTGGTTCCCCCGGGTGTG

ACCATTATGTTGTCAGGTCTCGTCTCAATCACGTCATCAGTTAGGCTTCAAATTCCCCCACCCCCACCCCAGCACCCGACTCACCCATCTCCAATGGAAC

ACTCACTTGTCTTGCTGAAATGGCCTTGTCCTTTTTGTTCACACAGTGATTATAAAGAACTCTATTGAAATTTCATTTACATGACATTTCAGCTATTAAA

CCTAAATGACAAGAGGGTGGAGTGGTATAGCTTATTCTCTTGATAAAAAATGTGATGTAGCCCTTGGAATTTTACATAAACCACTATATTTGGGAGATAG

TGGTTTTCTGTCAAAGGGCCGTAGGAAGGCTTAGTATGCCTGTGTTCTTTTCCATGCTTTATTTTCAAAGCTCCCTCCCCTCTGGCAAAATTGTCCTGAG

AGTGACAGTGACCCTGAGGGGTTTGCCAGACTGGGCTGACTGGTCAGTACCAACCTTTGCTGAGGCTCACCAAAATTGGATCATTTTGATGCTGAATGCT

GTTAACCAAGGTGTAAATGTACTCTTCAGTGTTGCTGATCTTTCTTATTTTTTAATTGTCATTATTTTTCTTGGGTTATTTTAAAATGATGTCCATGTTC

TCTCCAGGTAGCTGTAAAAAATAAATAAAATAAACTTCATTTAAGATACCTGTTAGTGCTACATGTCAGTTGTATGTGATTGCAGGGTCAAATGTCATTC

TTCTGCCTGAGGGAAACCAAGGAAATTGTGGTACAGAGGCCACCAACTTGTCAACTTCCCAAATCTTTTGTGCTCAAGCTCTTGATTCTTCTGGCCTTGT

GTTATTCTGCATTAGCACTTACCAGTCATTAGATCCTGTTCTAATGGACTAGCATGGAGCTCAGAGAGGGAGAGACGCTCTAGGAAGGAAACCCTGATTA

ACGTGTTTAGTTTAGTAGTAAAGAACATTTTTTGTTACTCTTCTGTGGGTTTAATTATCCATCCTGTTTAATGCTGTTCTCTGTCATCCTAGAAAATAAA

GCGTTTGTGGGAGCAGAGCTCCGCCCAGCAGGGGGCAGAGCAGATGTTTGCACTTGGCTCAGTATGTTATGAATGTGGCACAGTAAATAAAGTTTGTGTA

CAGAATATTAGTTTATTTCTATGAGAGCAATTATGTTCAGGATATATAAAAAATGTATCTAATTAAACCATTACGGATCTATTTTGTGCTCTAGAAATGT

TCTTTTTTTTGGGTTGGGGGGAGTGTCTATAGAGCTAAAAGTAAAATGTTGATGTGTTCTCATGGGTTTGGTTTCGTCTCCCAAATGCTCCGTGGCTTTT

GGGAAAGACTCCATATCACCCCAGGAATCTATCTTAATTGAGTTTGGTTTGTAAACACTTCTACTTTGAAAGTTGTGCATTGTGTGGCTCCTTCTCTGAA

ACAGAAACTAGCTTTATTAACAACATCTTCAGTACCTCTTCTGCCTGTCACGGAGATGTGGAACCTTTCTGCAGTGGCCGCTTTCAAAAAGAGAATGGCA

AATTGCATTGGATGGGTTTGGCTTCATTCTTCTAACCTGGGATCTAAAGGATGGATAAATGCTGTGATGAAGTAACATGCCCTACATCCTAAGTAGATCA

GGCCCTTAGGACAGACAGACAGACAGACAGACAGACAGACATCTGGCAGATGCCTCGTCTGGAAGAGAATTGGTGTTGTACTCTTGCATTGGCTTTTCAA

AACAACAAGCTTGTCTCTCTATCCTCTGGTCCTTACAAGCAGAAGGGGAGATGCTGCTGGGTACCATGTCATTGTCTGTGAAATGGGCTGTCTTCATGTG

TAATCTCAGTCATTCGGTATTAGAAACTGCTTCATTCATTTTCCTCATGAACAGTATTAATTCTTCATGAGTTAAAAGGTTCCTTATATACACATATTAT

GAGTTATTTTCCAAACTGATAGAAAAAAAAAAGTTAACCAAAAGTTCTCAGTTTCCATAAATTTTGTTTCTATCTGTACCTTCCTTTCCAAAATGAGTTA

ATTGTAAAGAAAAGGATATTAAATTTTTGGTAAAATAAAGTGGAATCCTGTGTGGGGTCCGTCTGCTTCTTCTCTCAGCATTAGATCAGATGAGGAAGGG

AACTGAACTCTTAGACAGGACGATGATAAAATCACTGCTCCCTTACATGTCTGCTCTCCCTCAGTGTTTCATCTCAGGCCTTCGGGAACTAAAATGTTTG

CTGTGCTTTTTAAAAAGCTGGATAAAAATGTTATATAATAAATGTCACACGTTGAAACTGATAC
Translation
 - UNI34501 -  - UNI36682 - MSSDEKGISPAHKTSTPTHRSASSSTSSQRESRQ SIHVLERTASSSTEPSVSRQLLEPEPIPLSK EADSW

EIIEGLKIGQTNVQKPDRHEGFMLKKRKWPLKGWHK RFFVLDNGMLKYSKAPLD IQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLK VKSQD

WFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPATSTAESSPAANVSVVDGK MQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAED D

LAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQ ANCVDISKKDKRVTRRWRTKSVSKDTKIQLQ EGPPAKGQFNTTRRRQRLAAAVATT VPFSATM

SPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKV VHSLLKSAFNSIAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQ ALNQ

NAELRSRLNRIHSESTICDHVVSVNIIPSPDE PGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENE ASDDESYISDVSDNISEDNT

SVADNISRQI ILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERM VLV

AAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQ VSHHPPISACHCESKNFVFWQD DIRWKNKFWGKSMEILPVGTLNVTLPK KYGDY

YVWNKVTTCIHNILSGRRWIEHYGEVTLRNTKSSVCICKLTFVK VNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRPG GSLPT

NYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQR RFLEEGNLEAAAAEKQRVEELQRSRRRYMEENNLEHIPKFFK KKVIDANQREAWVSNDTY

WELRKDPGFSKVDSPVLW
Transcript ENSMUST00000111930
Sequence
GGAGGCGCCGCGCGGCCGCCGCTGTCCGCGCTGGAGACCACAGCTCGGCACAGGCGGCGCCCGTCCTCCGCGCCTCCGGAGCCTCCTCCAGCCTGCGCGC

CGGGCAGATAGCACGGGCCATCTCCCACCGCGACCTACCGCTCGCCCTGCAG - UNI34501 - GTTCTTGCTGGGAAACCAACAAAAGAAGACAGTT

AAGGCACCAGCAGTGCCAACAGGGCTGGCAGACCGCAGAGGAGCAAGACGAGCTAAAGGCATCCAAAGCCAGTCCACTGAGAAGCAGTTGTAATGGTGCA

GCCAAGCTAGAAGACTTTGACACAAGCCGAAG - UNI36682 - GTGGTTTGGACTCGTCAGCAGTGGCCTGAGTTTTCCTAGTCCAGTCTGATCCGA

GGGAGATGGACTAAAGCCACAGATTGTCTGCTTCTCTGTCTGTGAATTGCAAGGAGGATTGGGATGGTCTTCCGTGCACATCCCTAGACTAATTGCAGCA

ATGAGTTCAGACGAGAAGGGCATATCCCCTGCTCATAAAACATCCACTCCGACCCATAGAAGTGCCTCGTCTTCAACATCTTCTCAGAGGGAAAGCAGAC

AG AGCATCCACGTTTTGGAGAGAACTGCTTCATCCAGCACGGAGCCCTCTGTCAGTCGGCAGTTGCTAGAGCCGGAGCCCATCCCCCTCTCCAAG GAA

GCTGACAGCTGGGAAATTATAGAAGGGCTGAAAATAGGCCAAACCAATGTCCAGAAACCAGACAGGCACGAGGGATTTATGCTGAAGAAAAGAAAATGGC

CTTTAAAGGGCTGGCACAAG CGCTTTTTTGTCCTGGATAATGGAATGCTGAAGTATTCCAAGGCGCCACTTGAT ATCCAAAAAGGAAAAGTGCACGGG

AGCATAGATGTCGGACTGTCTGTCATGTCGATTAAAAAGAAAGCTCGGAGGATAGACCTTGACACGGAAGAGCACATCTATCATTTGAAG GTGAAATCC

CAGGACTGGTTTGACGCTTGGGTCTCCAAACTGCGCCATCACAGGTTGTACCGTCAGAATGAAATTGTGAGGTCGCCGAGAGATGCCAGTTTCCACATAT

TTCCTGCAACTTCGACAGCTGAGTCCTCCCCGGCTGCTAATGTCTCTGTTGTGGATGGAAAG ATGCAGCCCAACAGCTTTCCATGGCAGTCGCCATTAC

CATGCAGTAACAGCCTCCCTGCGACCTGCACAACTGGGCAGAGTAAAGTGGCAGCCTGGCTGCAGGACTCAGAAGAAATGGACAGGTGTGCAGAAG ATC

TTGCACACTGCCAGTCAAACCTTGTGGAACTTAGCAAGCTCCTGCAAAACTTGGAGATCCTTCAGAGAACTCAGTCGGCGCCTAACTTCACTGACATGCA

G GAAGGGCCACCTGCGAAGGGCCAGTTCAACACAACTCGGCGCCGGCAGAGGCTAGCGGCAGCAGTGGCTACAACA GTTCCTTTCAGCGCCACCATGT

CACCCGTGCGTCTGCACTCCTCCAACCCCAACCTTTGTGCAGACATTGAGTTCCAGACCCCTCCTAGCCACCTCACCGACCCTCTGGAAAGTTCCACGGA

TTATACCAAGCTACAAGAAGAATTTTGTCTAATTGCACAGAAAG TGCATTCTCTTCTGAAGTCTGCATTTAACAGCATAGCTATAGAGAAGGAGAAGCT

GAAGCAGGTGGTCTCGGAGCAAGATCACAACAAAGGCCACAGCACACAGATGGCCAGACTCCGGCAGTCACTGTCACAG GCACTTAACCAGAACGCTGA

GCTCCGGAGTCGGCTGAACAGAATACACTCAGAGTCTACCATTTGTGATCACGTTGTCAGTGTAAATATTATCCCTAGCCCCGATGAG CCTGGTGAGCA

AATCCATGTCAGCCTCCCTCTGTCACAGCAGGTGGCCAACGAGAGCCGCCTCTCCATGTCAGAATCCGTGTCAGAATTCTTCGATGCCCAAGAGGTGCTC

CTGTCTGCAAGCTCATCAGAGAATGAG GCTTCTGATGATGAGTCCTACATCAGCGACGTGAGTGACAACATATCTGAGGACAACACCAGTGTCGCCGAC

AACATTTCTCGGCAAA TCCTGAATGGGGAGCTCACAGGAGGCGCCTTCCGCAATGGCCGTCGCACCTGCCTGCCTGCTCCTTGCCCGGACACCAGTAAC

ATTAACCTGTGGAATATCTTGAGGAACAACATTGGCAAAGACCTGTCGAAGGTCTCCATGCCCGTGGAACTCAACGAGCCCCTCAACACCCTGCAGCACC

TCTGTGAGGAAATGGAATACAGTGAGCTCCTGGACAAGGCCTCAGAGACCGACGACCCCTACGAGAGGATG GTTCTCGTCGCTGCCTTTGCAGTCTCAG

GGTACTGTTCCACCTACTTCCGAGCAGGAAGCAAGCCATTCAATCCGGTCCTGGGGGAGACCTATGAATGCATAAGAGAAGATAAGGGGTTTCGGTTCTT

CTCAGAACAA GTTAGCCATCATCCACCCATTTCTGCCTGTCACTGTGAATCCAAGAATTTTGTGTTTTGGCAAG ATATCAGATGGAAAAATAAGTTCT

GGGGAAAGTCCATGGAAATCCTGCCTGTCGGAACCCTGAACGTCACGCTTCCAAA ATATGGGGATTACTATGTGTGGAATAAAGTCACCACGTGCATAC

ACAATATCCTGAGTGGGAGGAGATGGATCGAGCACTACGGTGAAGTGACCCTTAGAAATACCAAAAGCAGTGTTTGCATTTGCAAACTCACGTTTGTCAA

G GTGAATTACTGGAACTCCAACGTGAATGAAGTCCAGGGGGTGGTGATAGACCAGGAGGGGAAGGTGGTGCACCGGCTGTTTGGGAAATGGCACGAAGG

ACTCTACTGCGGGGTGGCCCCCTCGGCAAAGTGCATCTGGAGACCAG GTTCTCTGCCAACCAACTATGAGCTCTACTATGGCTTTACAAGATTTGCTGT

GGAGCTCAATGAGTTGGACCCCGTCCTGAAGGACCTCCTTCCCCCCACAGATGCCCGATTCCGGCCAGATCAAAG GTTTTTGGAAGAAGGGAACCTAGA

AGCCGCAGCCGCAGAGAAACAAAGAGTTGAGGAACTCCAAAGATCGCGAAGACGCTACATGGAGGAAAACAACCTTGAACATATACCAAAATTTTTTAA 

AAAAGTTATTGATGCAAATCAAAGAGAAGCCTGGGTTTCTAACGACACCTACTGGGAGCTTCGAAAGGACCCTGGGTTTAGCAAAGTAGACAGCCCCGTT

CTTTGGTAAACTGGAGACATAGAGCTAGCCAATATCCCACACTCGGAATGAATAAATAACTATGCACAATTATGTTTCTTATAGCTACGCGTGGTTTCTG

GGTCGACTGAAAAGCTCCCATTGGCTTTTCTATTCATCTTTATAATGGATTTTCAAAAGTGCATTAGACAAGGCTCCTAACCACTTTTGGATCCTTTCTG

TTTTGCTGCAACCATATTCCTTAAATAAATAAATAAATAAATAAATAAAACCCATGCCCTCCTCGGAAAGCAGCCTAAAAGAAGGAGAATATAAAATCCA

AAGTCGGGAGAGTCAGAAAAGAAGATGAAACTGTAACAGGCGCTTCAAGCTGATCAGGAGAGTTTTAAATGATGTACAAACTACACGTTCCGTCTGCTGT

CTGAAAGCGTCATCCCATACCTTAGGAGCTCCGGGGCCGTAGTCGGTTAGTTCAGACTTGAAGTGTGTTCTTTTGATGTGGTGTGCTTGTTCTCAGCCTC

GTGAAAATCGACAACGCGATGCTTCCCGAAACCCACTCCATCTTTACGACATTGTTCATGCCTTAAGAAATGCAAAGATGTACAATAAACTGTTTTCTAA

ATGTGTGCTCATAGGTGTATGTGAAGGACAGAGTGCTGGCGTGATTCACTTTCTTGGTCAGAAGGTTGATTCAGCTGATAGAAGGATTAAATGAGGGAAA

AACACACTTTCCTTTGCTAAGTCAGTTCTGCTGTGGTGGATCTGAGGGGCAAGAGGGCTAAGGTACTGTATCCTAAGTTAGATCTCTGTATCCAGGTCGT

TCTTTAAGTTCCTGTCCTATGTCCAGATAGTAAGCCATCCCTCCTCCGTCTGACCTCACAGTGTGCCCTGGTATTTGGCAAAAGTTGTATCTGATTTGGA

CGCCCGTCATCAGTGTTAAACTTCAGTAGGAAGTAACAAAGCCCAGTTTCTGCCTGGGCTGGGTGGTACCACAAAGCACACAGGCCATAGAACACATCCC

TGGCTCATGCCCGCCACTCGACACTGTTGCGATTCCATGGAGAACGAAAGCTTATTTGCATTATGTAAATGGATCCTATGCATAATCATGTTTCTTTTTT

AAAAAAAATCAAGCGGTTCCATATGATACACGGTTACATATTAAGCATCTACCTTGCTAAGGGCAGATATATAAAACTTAGGCTTAAAAAAAAGTAATCC

ATTCCAAAGGTGGGGTCAGGCAAGGTTTGATTTCAATCCTTGAGGTTTTGTTTTTCCTCCACGGGTACACAGAGGCTTTTGTAGGAAGCTTGCATTGGCG

TTTTTAAGTTCTTGCATGTACATGACAATATAAACACCCGTATGTTTTTTAAAAAAAAATCTCTTAAGGGGGCTTCCTAGAGAATTAGAAACTTATATAT

ATTTTATTGTTAGAGTTTTATTCTTAGATTCTTACCATCTGAATTTAAGTGTTACTTTAGACTCTGATAACAAGGTTAGTGACATTTTATATTTTGTTAA

GAGGTATCTATCAATCTCGGTGTTATTTCTCCCCCCTCCCCGCCCCCGCAAAGTATTCCTAATAATGGCTAACTCACCATAAAACCCAAACCTTTTGTGA

ACATGGAGGGAAATCCAGAGTTTCCCCTAGATGGAGCAATATTTTAGTTATCCCCAAATTCATCTCCCCATTCATGTACACCATGCACACAGCTGTTAGT

CATTCGAATGAAACTTCGCTCTCCAAAGAGTTCCCGAAGTCAGAGCCAGAGCCAGGCTTCCGCTTACACGGCTTTCTCCATGTGCTCCTGAGTCCTAGGT

GACTCGCCCTGCAGTTGCAAAACCTTCCCCCGTGTCACGGACTACTTTTTTTCTCGGTTCAACCCGATGCTGTTTTATCAGTGCATCTCTAGTTATGTCT

GATTTTATATTGAGTTAGGACTTAATTACAGTCCCGTGGACCTCCTCATAAAAGCTGGTTCTCCTCCAACTGAGAAAGCTTACAGTACAATTTAAAGTGG

GTCTCGCCTGCACTTACTAGTGTCTGACGAAACAGTCTTACATCTGCCTAAGTAATAGAAGAGCCCTGCAGAATAGAGATGCCACAAGGAGGGACTGCGA

AGGTGAGGTGATCAAAACACAATAGGAGATGTCCATTTAGTAAAGGACAGAAGGCCCAGGACACAGCAGGGAAGTAAAGACAGCTCCCAGGTTTGGATTA

ACTGAGAAGAAAGGAGAAACAACAGATGAAGCCTTTGTAGTCAGATAGTAAGGTTAAGATGACAAATAAGATAAGGTCAGATCTACCCGGAAACTCTAAT

AAGAATTTCAGGATGCAAACGAGAGAAGCATGGGATTAATTACAATCACATTGTATGGCATCCTCCATTTTGAATCTGTTTGGAGATTTTGGTTCCCCCG

GGTGTGACCATTATGTTGTCAGGTCTCGTCTCAATCACGTCATCAGTTAGGCTTCAAATTCCCCCACCCCCACCCCAGCACCCGACTCACCCATCTCCAA

TGGAACACTCACTTGTCTTGCTGAAATGGCCTTGTCCTTTTTGTTCACACAGTGATTATAAAGAACTCTATTGAAATTTCATTTACATGACATTTCAGCT

ATTAAACCTAAATGACAAGAGGGTGGAGTGGTATAGCTTATTCTCTTGATAAAAAATGTGATGTAGCCCTTGGAATTTTACATAAACCACTATATTTGGG

AGATAGTGGTTTTCTGTCAAAGGGCCGTAGGAAGGCTTAGTATGCCTGTGTTCTTTTCCATGCTTTATTTTCAAAGCTCCCTCCCCTCTGGCAAAATTGT

CCTGAGAGTGACAGTGACCCTGAGGGGTTTGCCAGACTGGGCTGACTGGTCAGTACCAACCTTTGCTGAGGCTCACCAAAATTGGATCATTTTGATGCTG

AATGCTGTTAACCAAGGTGTAAATGTACTCTTCAGTGTTGCTGATCTTTCTTATTTTTTAATTGTCATTATTTTTCTTGGGTTATTTTAAAATGATGTCC

ATGTTCTCTCCAGGTAGCTGTAAAAAATAAATAAAATAAACTTCATTTAAGATACCTGTTAGTGCTACATGTCAGTTGTATGTGATTGCAGGGTCAAATG

TCATTCTTCTGCCTGAGGGAAACCAAGGAAATTGTGGTACAGAGGCCACCAACTTGTCAACTTCCCAAATCTTTTGTGCTCAAGCTCTTGATTCTTCTGG

CCTTGTGTTATTCTGCATTAGCACTTACCAGTCATTAGATCCTGTTCTAATGGACTAGCATGGAGCTCAGAGAGGGAGAGACGCTCTAGGAAGGAAACCC

TGATTAACGTGTTTAGTTTAGTAGTAAAGAACATTTTTTGTTACTCTTCTGTGGGTTTAATTATCCATCCTGTTTAATGCTGTTCTCTGTCATCCTAGAA

AATAAAGCGTTTGTGGGAGCAGAGCTCCGCCCAGCAGGGGGCAGAGCAGATGTTTGCACTTGGCTCAGTATGTTATGAATGTGGCACAGTAAATAAAGTT

TGTGTACAGAATATTAGTTTATTTCTATGAGAGCAATTATGTTCAGGATATATAAAAAATGTATCTAATTAAACCATTACGGATCTATTTTGTGCTCTAG

AAATGTTCTTTTTTTTGGGTTGGGGGGAGTGTCTATAGAGCTAAAAGTAAAATGTTGATGTGTTCTCATGGGTTTGGTTTCGTCTCCCAAATGCTCCGTG

GCTTTTGGGAAAGACTCCATATCACCCCAGGAATCTATCTTAATTGAGTTTGGTTTGTAAACACTTCTACTTTGAAAGTTGTGCATTGTGTGGCTCCTTC

TCTGAAACAGAAACTAGCTTTATTAACAACATCTTCAGTACCTCTTCTGCCTGTCACGGAGATGTGGAACCTTTCTGCAGTGGCCGCTTTCAAAAAGAGA

ATGGCAAATTGCATTGGATGGGTTTGGCTTCATTCTTCTAACCTGGGATCTAAAGGATGGATAAATGCTGTGATGAAGTAACATGCCCTACATCCTAAGT

AGATCAGGCCCTTAGGACAGACAGACAGACAGACAGACAGACAGACATCTGGCAGATGCCTCGTCTGGAAGAGAATTGGTGTTGTACTCTTGCATTGGCT

TTTCAAAACAACAAGCTTGTCTCTCTATCCTCTGGTCCTTACAAGCAGAAGGGGAGATGCTGCTGGGTACCATGTCATTGTCTGTGAAATGGGCTGTCTT

CATGTGTAATCTCAGTCATTCGGTATTAGAAACTGCTTCATTCATTTTCCTCATGAACAGTATTAATTCTTCATGAGTTAAAAGGTTCCTTATATACACA

TATTATGAGTTATTTTCCAAACTGATAGAAAAAAAAAAGTTAACCAAAAGTTCTCAGTTTCCATAAATTTTGTTTCTATCTGTACCTTCCTTTCCAAAAT

GAGTTAATTGTAAAGAAAAGGATATTAAATTTTTGGTAAAATAAAGTGGAATCCTGTGTGGGGTCCGTCTGCTTCTTCTCTCAGCATTAGATCAGATGAG

GAAGGGAACTGAACTCTTAGACAGGACGATGATAAAATCACTGCTCCCTTACATGTCTGCTCTCCCTCAGTGTTTCATCTCAGGCCTTCGGGAACTAAAA

TGTTTGCTGTGCTTTTTAAAAAGCTGGATAAAAATGTTATATAATAAATGTCACACGTTGAAACTGATAC
Translation
 - UNI34501 -  - UNI36682 - MSSDEKGISPAHKTSTPTHRSASSSTSSQRESRQ SIHVLERTASSSTEPSVSRQLLEPEPIPLSK EADSW

EIIEGLKIGQTNVQKPDRHEGFMLKKRKWPLKGWHK RFFVLDNGMLKYSKAPLD IQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLK VKSQD

WFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPATSTAESSPAANVSVVDGK MQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAED D

LAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQ EGPPAKGQFNTTRRRQRLAAAVATT VPFSATMSPVRLHSSNPNLCADIEFQTPPSHLTDPLESS

TDYTKLQEEFCLIAQKV VHSLLKSAFNSIAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQ ALNQNAELRSRLNRIHSESTICDHVVSVNIIPSPDE

 PGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENE ASDDESYISDVSDNISEDNTSVADNISRQI ILNGELTGGAFRNGRRTCLPA

PCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERM VLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIR

EDKGFRFFSEQ VSHHPPISACHCESKNFVFWQD DIRWKNKFWGKSMEILPVGTLNVTLPK KYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTLRNTK

SSVCICKLTFVK VNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRPG GSLPTNYELYYGFTRFAVELNELDPVLKDLLPPTDAR

FRPDQR RFLEEGNLEAAAAEKQRVEELQRSRRRYMEENNLEHIPKFFK KKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
Transcript ENSMUST00000111929
Sequence
GGAGGCGCCGCGCGGCCGCCGCTGTCCGCGCTGGAGACCACAGCTCGGCACAGGCGGCGCCCGTCCTCCGCGCCTCCGGAGCCTCCTCCAGCCTGCGCGC

CGGGCAGATAGCACGGGCCATCTCCCACCGCGACCTACCGCTCGCCCTGCAG - UNI34501 - GTTCTTGCTGGGAAACCAACAAAAGAAGACAGTT

AAGGCACCAGCAGTGCCAACAGGGCTGGCAGACCGCAGAGGAGCAAGACGAGCTAAAGGCATCCAAAGCCAGTCCACTGAGAAGCAGTTGTAATGGTGCA

GCCAAGCTAGAAGACTTTGACACAAGCCGAAG - UNI36682 - GCCTCCAGCAGAAGGTGTGGCCCAGATTAAAGGCGTGTACCACCACAGCTAGAT

TTGGAACTTGCCCTGTCCCAGGCTGGCCTTGGAATTCAGAGATCTGCTTGCCTCAGTCTCCTGCGATCTTGCCTGAACCTGAGCTTTTTATGGCCACAGT

GCCTCAAGATCTCGATCAAAAGGACGTCCCTTGTCAAGATCCAGGTCAGACACCAGAGTCCTCCAGCCTCAAGATCTGGATCACAG GTGGTTTGGACTC

GTCAGCAGTGGCCTGAGTTTTCCTAGTCCAGTCTGATCCGAGGGAGATGGACTAAAGCCACAGATTGTCTGCTTCTCTGTCTGTGAATTGCAAGGAGGAT

TGGGATGGTCTTCCGTGCACATCCCTAGACTAATTGCAGCAATGAGTTCAGACGAGAAGGGCATATCCCCTGCTCATAAAACATCCACTCCGACCCATAG

AAGTGCCTCGTCTTCAACATCTTCTCAGAGGGAAAGCAGACAG AGCATCCACGTTTTGGAGAGAACTGCTTCATCCAGCACGGAGCCCTCTGTCAGTCG

GCAGTTGCTAGAGCCGGAGCCCATCCCCCTCTCCAAG GAAGCTGACAGCTGGGAAATTATAGAAGGGCTGAAAATAGGCCAAACCAATGTCCAGAAACC

AGACAGGCACGAGGGATTTATGCTGAAGAAAAGAAAATGGCCTTTAAAGGGCTGGCACAAG CGCTTTTTTGTCCTGGATAATGGAATGCTGAAGTATTC

CAAGGCGCCACTTGAT ATCCAAAAAGGAAAAGTGCACGGGAGCATAGATGTCGGACTGTCTGTCATGTCGATTAAAAAGAAAGCTCGGAGGATAGACCT

TGACACGGAAGAGCACATCTATCATTTGAAG GTGAAATCCCAGGACTGGTTTGACGCTTGGGTCTCCAAACTGCGCCATCACAGGTTGTACCGTCAGAA

TGAAATTGTGAGGTCGCCGAGAGATGCCAGTTTCCACATATTTCCTGCAACTTCGACAGCTGAGTCCTCCCCGGCTGCTAATGTCTCTGTTGTGGATGGA

AAG ATGCAGCCCAACAGCTTTCCATGGCAGTCGCCATTACCATGCAGTAACAGCCTCCCTGCGACCTGCACAACTGGGCAGAGTAAAGTGGCAGCCTGG

CTGCAGGACTCAGAAGAAATGGACAGGTGTGCAGAAG ATCTTGCACACTGCCAGTCAAACCTTGTGGAACTTAGCAAGCTCCTGCAAAACTTGGAGATC

CTTCAGAGAACTCAGTCGGCGCCTAACTTCACTGACATGCAG GCTAACTGTGTAGATATTTCAAAGAAAGACAAGCGGGTCACAAGACGCTGGAGGACA

AAAAGTGTCAGCAAAGATACAAAAATACAGCTCCAG GAAGGGCCACCTGCGAAGGGCCAGTTCAACACAACTCGGCGCCGGCAGAGGCTAGCGGCAGCA

GTGGCTACAACA GTTCCTTTCAGCGCCACCATGTCACCCGTGCGTCTGCACTCCTCCAACCCCAACCTTTGTGCAGACATTGAGTTCCAGACCCCTCCT

AGCCACCTCACCGACCCTCTGGAAAGTTCCACGGATTATACCAAGCTACAAGAAGAATTTTGTCTAATTGCACAGAAAG TGCATTCTCTTCTGAAGTCT

GCATTTAACAGCATAGCTATAGAGAAGGAGAAGCTGAAGCAGGTGGTCTCGGAGCAAGATCACAACAAAGGCCACAGCACACAGATGGCCAGACTCCGGC

AGTCACTGTCACAG GCACTTAACCAGAACGCTGAGCTCCGGAGTCGGCTGAACAGAATACACTCAGAGTCTACCATTTGTGATCACGTTGTCAGTGTAA

ATATTATCCCTAGCCCCGATGAG CCTGGTGAGCAAATCCATGTCAGCCTCCCTCTGTCACAGCAGGTGGCCAACGAGAGCCGCCTCTCCATGTCAGAAT

CCGTGTCAGAATTCTTCGATGCCCAAGAGGTGCTCCTGTCTGCAAGCTCATCAGAGAATGAG GCTTCTGATGATGAGTCCTACATCAGCGACGTGAGTG

ACAACATATCTGAGGACAACACCAGTGTCGCCGACAACATTTCTCGGCAAA TCCTGAATGGGGAGCTCACAGGAGGCGCCTTCCGCAATGGCCGTCGCA

CCTGCCTGCCTGCTCCTTGCCCGGACACCAGTAACATTAACCTGTGGAATATCTTGAGGAACAACATTGGCAAAGACCTGTCGAAGGTCTCCATGCCCGT

GGAACTCAACGAGCCCCTCAACACCCTGCAGCACCTCTGTGAGGAAATGGAATACAGTGAGCTCCTGGACAAGGCCTCAGAGACCGACGACCCCTACGAG

AGGATG GTTCTCGTCGCTGCCTTTGCAGTCTCAGGGTACTGTTCCACCTACTTCCGAGCAGGAAGCAAGCCATTCAATCCGGTCCTGGGGGAGACCTAT

GAATGCATAAGAGAAGATAAGGGGTTTCGGTTCTTCTCAGAACAA GTTAGCCATCATCCACCCATTTCTGCCTGTCACTGTGAATCCAAGAATTTTGTG

TTTTGGCAAG ATATCAGATGGAAAAATAAGTTCTGGGGAAAGTCCATGGAAATCCTGCCTGTCGGAACCCTGAACGTCACGCTTCCAAA ATATGGGGA

TTACTATGTGTGGAATAAAGTCACCACGTGCATACACAATATCCTGAGTGGGAGGAGATGGATCGAGCACTACGGTGAAGTGACCCTTAGAAATACCAAA

AGCAGTGTTTGCATTTGCAAACTCACGTTTGTCAAG GTGAATTACTGGAACTCCAACGTGAATGAAGTCCAGGGGGTGGTGATAGACCAGGAGGGGAAG

GTGGTGCACCGGCTGTTTGGGAAATGGCACGAAGGACTCTACTGCGGGGTGGCCCCCTCGGCAAAGTGCATCTGGAGACCAG GTTCTCTGCCAACCAAC

TATGAGCTCTACTATGGCTTTACAAGATTTGCTGTGGAGCTCAATGAGTTGGACCCCGTCCTGAAGGACCTCCTTCCCCCCACAGATGCCCGATTCCGGC

CAGATCAAAG GTTTTTGGAAGAAGGGAACCTAGAAGCCGCAGCCGCAGAGAAACAAAGAGTTGAGGAACTCCAAAGATCGCGAAGACGCTACATGGAGG

AAAACAACCTTGAACATATACCAAAATTTTTTAA AAAAGTTATTGATGCAAATCAAAGAGAAGCCTGGGTTTCTAACGACACCTACTGGGAGCTTCGAA

AGGACCCTGGGTTTAGCAAAGTAGACAGCCCCGTTCTTTGGTAAACTGGAGACATAGAGCTAGCCAATATCCCACACTCGGAATGAATAAATAACTATGC

ACAATTATGTTTCTTATAGCTACGCGTGGTTTCTGGGTCGACTGAAAAGCTCCCATTGGCTTTTCTATTCATCTTTATAATGGATTTTCAAAAGTGCATT

AGACAAGGCTCCTAACCACTTTTGGATCCTTTCTGTTTTGCTGCAACCATATTCCTTAAATAAATAAATAAATAAATAAATAAAACCCATGCCCTCCTCG

GAAAGCAGCCTAAAAGAAGGAGAATATAAAATCCAAAGTCGGGAGAGTCAGAAAAGAAGATGAAACTGTAACAGGCGCTTCAAGCTGATCAGGAGAGTTT

TAAATGATGTACAAACTACACGTTCCGTCTGCTGTCTGAAAGCGTCATCCCATACCTTAGGAGCTCCGGGGCCGTAGTCGGTTAGTTCAGACTTGAAGTG

TGTTCTTTTGATGTGGTGTGCTTGTTCTCAGCCTCGTGAAAATCGACAACGCGATGCTTCCCGAAACCCACTCCATCTTTACGACATTGTTCATGCCTTA

AGAAATGCAAAGATGTACAATAAACTGTTTTCTAAATGTGTGCTCATAGGTGTATGTGAAGGACAGAGTGCTGGCGTGATTCACTTTCTTGGTCAGAAGG

TTGATTCAGCTGATAGAAGGATTAAATGAGGGAAAAACACACTTTCCTTTGCTAAGTCAGTTCTGCTGTGGTGGATCTGAGGGGCAAGAGGGCTAAGGTA

CTGTATCCTAAGTTAGATCTCTGTATCCAGGTCGTTCTTTAAGTTCCTGTCCTATGTCCAGATAGTAAGCCATCCCTCCTCCGTCTGACCTCACAGTGTG

CCCTGGTATTTGGCAAAAGTTGTATCTGATTTGGACGCCCGTCATCAGTGTTAAACTTCAGTAGGAAGTAACAAAGCCCAGTTTCTGCCTGGGCTGGGTG

GTACCACAAAGCACACAGGCCATAGAACACATCCCTGGCTCATGCCCGCCACTCGACACTGTTGCGATTCCATGGAGAACGAAAGCTTATTTGCATTATG

TAAATGGATCCTATGCATAATCATGTTTCTTTTTTAAAAAAAATCAAGCGGTTCCATATGATACACGGTTACATATTAAGCATCTACCTTGCTAAGGGCA

GATATATAAAACTTAGGCTTAAAAAAAAGTAATCCATTCCAAAGGTGGGGTCAGGCAAGGTTTGATTTCAATCCTTGAGGTTTTGTTTTTCCTCCACGGG

TACACAGAGGCTTTTGTAGGAAGCTTGCATTGGCGTTTTTAAGTTCTTGCATGTACATGACAATATAAACACCCGTATGTTTTTTAAAAAAAAATCTCTT

AAGGGGGCTTCCTAGAGAATTAGAAACTTATATATATTTTATTGTTAGAGTTTTATTCTTAGATTCTTACCATCTGAATTTAAGTGTTACTTTAGACTCT

GATAACAAGGTTAGTGACATTTTATATTTTGTTAAGAGGTATCTATCAATCTCGGTGTTATTTCTCCCCCCTCCCCGCCCCCGCAAAGTATTCCTAATAA

TGGCTAACTCACCATAAAACCCAAACCTTTTGTGAACATGGAGGGAAATCCAGAGTTTCCCCTAGATGGAGCAATATTTTAGTTATCCCCAAATTCATCT

CCCCATTCATGTACACCATGCACACAGCTGTTAGTCATTCGAATGAAACTTCGCTCTCCAAAGAGTTCCCGAAGTCAGAGCCAGAGCCAGGCTTCCGCTT

ACACGGCTTTCTCCATGTGCTCCTGAGTCCTAGGTGACTCGCCCTGCAGTTGCAAAACCTTCCCCCGTGTCACGGACTACTTTTTTTCTCGGTTCAACCC

GATGCTGTTTTATCAGTGCATCTCTAGTTATGTCTGATTTTATATTGAGTTAGGACTTAATTACAGTCCCGTGGACCTCCTCATAAAAGCTGGTTCTCCT

CCAACTGAGAAAGCTTACAGTACAATTTAAAGTGGGTCTCGCCTGCACTTACTAGTGTCTGACGAAACAGTCTTACATCTGCCTAAGTAATAGAAGAGCC

CTGCAGAATAGAGATGCCACAAGGAGGGACTGCGAAGGTGAGGTGATCAAAACACAATAGGAGATGTCCATTTAGTAAAGGACAGAAGGCCCAGGACACA

GCAGGGAAGTAAAGACAGCTCCCAGGTTTGGATTAACTGAGAAGAAAGGAGAAACAACAGATGAAGCCTTTGTAGTCAGATAGTAAGGTTAAGATGACAA

ATAAGATAAGGTCAGATCTACCCGGAAACTCTAATAAGAATTTCAGGATGCAAACGAGAGAAGCATGGGATTAATTACAATCACATTGTATGGCATCCTC

CATTTTGAATCTGTTTGGAGATTTTGGTTCCCCCGGGTGTGACCATTATGTTGTCAGGTCTCGTCTCAATCACGTCATCAGTTAGGCTTCAAATTCCCCC

ACCCCCACCCCAGCACCCGACTCACCCATCTCCAATGGAACACTCACTTGTCTTGCTGAAATGGCCTTGTCCTTTTTGTTCACACAGTGATTATAAAGAA

CTCTATTGAAATTTCATTTACATGACATTTCAGCTATTAAACCTAAATGACAAGAGGGTGGAGTGGTATAGCTTATTCTCTTGATAAAAAATGTGATGTA

GCCCTTGGAATTTTACATAAACCACTATATTTGGGAGATAGTGGTTTTCTGTCAAAGGGCCGTAGGAAGGCTTAGTATGCCTGTGTTCTTTTCCATGCTT

TATTTTCAAAGCTCCCTCCCCTCTGGCAAAATTGTCCTGAGAGTGACAGTGACCCTGAGGGGTTTGCCAGACTGGGCTGACTGGTCAGTACCAACCTTTG

CTGAGGCTCACCAAAATTGGATCATTTTGATGCTGAATGCTGTTAACCAAGGTGTAAATGTACTCTTCAGTGTTGCTGATCTTTCTTATTTTTTAATTGT

CATTATTTTTCTTGGGTTATTTTAAAATGATGTCCATGTTCTCTCCAGGTAGCTGTAAAAAATAAATAAAATAAACTTCATTTAAGATACCTGTTAGTGC

TACATGTCAGTTGTATGTGATTGCAGGGTCAAATGTCATTCTTCTGCCTGAGGGAAACCAAGGAAATTGTGGTACAGAGGCCACCAACTTGTCAACTTCC

CAAATCTTTTGTGCTCAAGCTCTTGATTCTTCTGGCCTTGTGTTATTCTGCATTAGCACTTACCAGTCATTAGATCCTGTTCTAATGGACTAGCATGGAG

CTCAGAGAGGGAGAGACGCTCTAGGAAGGAAACCCTGATTAACGTGTTTAGTTTAGTAGTAAAGAACATTTTTTGTTACTCTTCTGTGGGTTTAATTATC

CATCCTGTTTAATGCTGTTCTCTGTCATCCTAGAAAATAAAGCGTTTGTGGGAGCAGAGCTCCGCCCAGCAGGGGGCAGAGCAGATGTTTGCACTTGGCT

CAGTATGTTATGAATGTGGCACAGTAAATAAAGTTTGTGTACAGAATATTAGTTTATTTCTATGAGAGCAATTATGTTCAGGATATATAAAAAATGTATC

TAATTAAACCATTACGGATCTATTTTGTGCTCTAGAAATGTTCTTTTTTTTGGGTTGGGGGGAGTGTCTATAGAGCTAAAAGTAAAATGTTGATGTGTTC

TCATGGGTTTGGTTTCGTCTCCCAAATGCTCCGTGGCTTTTGGGAAAGACTCCATATCACCCCAGGAATCTATCTTAATTGAGTTTGGTTTGTAAACACT

TCTACTTTGAAAGTTGTGCATTGTGTGGCTCCTTCTCTGAAACAGAAACTAGCTTTATTAACAACATCTTCAGTACCTCTTCTGCCTGTCACGGAGATGT

GGAACCTTTCTGCAGTGGCCGCTTTCAAAAAGAGAATGGCAAATTGCATTGGATGGGTTTGGCTTCATTCTTCTAACCTGGGATCTAAAGGATGGATAAA

TGCTGTGATGAAGTAACATGCCCTACATCCTAAGTAGATCAGGCCCTTAGGACAGACAGACAGACAGACAGACAGACAGACATCTGGCAGATGCCTCGTC

TGGAAGAGAATTGGTGTTGTACTCTTGCATTGGCTTTTCAAAACAACAAGCTTGTCTCTCTATCCTCTGGTCCTTACAAGCAGAAGGGGAGATGCTGCTG

GGTACCATGTCATTGTCTGTGAAATGGGCTGTCTTCATGTGTAATCTCAGTCATTCGGTATTAGAAACTGCTTCATTCATTTTCCTCATGAACAGTATTA

ATTCTTCATGAGTTAAAAGGTTCCTTATATACACATATTATGAGTTATTTTCCAAACTGATAGAAAAAAAAAAGTTAACCAAAAGTTCTCAGTTTCCATA

AATTTTGTTTCTATCTGTACCTTCCTTTCCAAAATGAGTTAATTGTAAAGAAAAGGATATTAAATTTTTGGTAAAATAAAGTGGAATCCTGTGTGGGGTC

CGTCTGCTTCTTCTCTCAGCATTAGATCAGATGAGGAAGGGAACTGAACTCTTAGACAGGACGATGATAAAATCACTGCTCCCTTACATGTCTGCTCTCC

CTCAGTGTTTCATCTCAGGCCTTCGGGAACTAAAATGTTTGCTGTGCTTTTTAAAAAGCTGGATAAAAATGTTATATAATAAATGTCACACGTTGAAACT

GATACACAA
Translation
 - UNI34501 -  - UNI36682 -  MSSDEKGISPAHKTSTPTHRSASSSTSSQRESRQ SIHVLERTASSSTEPSVSRQLLEPEPIPLSK EADS

WEIIEGLKIGQTNVQKPDRHEGFMLKKRKWPLKGWHK RFFVLDNGMLKYSKAPLD IQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLK VKSQ

DWFDAWVSKLRHHRLYRQNEIVRSPRDASFHIFPATSTAESSPAANVSVVDGK MQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAED 

DLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQ ANCVDISKKDKRVTRRWRTKSVSKDTKIQLQ EGPPAKGQFNTTRRRQRLAAAVATT VPFSAT

MSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKV VHSLLKSAFNSIAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQ ALN

QNAELRSRLNRIHSESTICDHVVSVNIIPSPDE PGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENE ASDDESYISDVSDNISEDN

TSVADNISRQI ILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNILRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERM VL

VAAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQ VSHHPPISACHCESKNFVFWQD DIRWKNKFWGKSMEILPVGTLNVTLPK KYGD

YYVWNKVTTCIHNILSGRRWIEHYGEVTLRNTKSSVCICKLTFVK VNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRPG GSLP

TNYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQR RFLEEGNLEAAAAEKQRVEELQRSRRRYMEENNLEHIPKFFK KKVIDANQREAWVSNDT

YWELRKDPGFSKVDSPVLW
Transcript ENSMUST00000063499
Sequence
GGAGGCGCCGCGCGGCCGCCGCTGTCCGCGCTGGAGACCACAGCTCGGCACAGGCGGCGCCCGTCCTCCGCGCCTCCGGAGCCTCCTCCAGCCTGCGCGC

CGGGCAGATAGCACGGGCCATCTCCCACCGCGACCTACCGCTCGCCCTGCAG - UNI34501 - GTTCTTGCTGGGAAACCAACAAAAGAAGACAGTT

AAGGCACCAGCAGTGCCAACAGGGCTGGCAGACCGCAGAGGAGCAAGACGAGCTAAAGGCATCCAAAGCCAGTCCACTGAGAAGCAGTTGTAATGGTGCA

GCCAAGCTAGAAGACTTTGACACAAGCCGAAG - UNI36682 - GTGGTTTGGACTCGTCAGCAGTGGCCTGAGTTTTCCTAGTCCAGTCTGATCCGA

GGGAGATGGACTAAAGCCACAGATTGTCTGCTTCTCTGTCTGTGAATTGCAAGGAGGATTGGGATGGTCTTCCGTGCACATCCCTAGACTAATTGCAGCA

ATGAGTTCAGACGAGAAGGGCATATCCCCTGCTCATAAAACATCCACTCCGACCCATAGAAGTGCCTCGTCTTCAACATCTTCTCAGAGGGAAAGCAGAC

AG AGCATCCACGTTTTGGAGAGAACTGCTTCATCCAGCACGGAGCCCTCTGTCAGTCGGCAGTTGCTAGAGCCGGAGCCCATCCCCCTCTCCAAG GAA

GCTGACAGCTGGGAAATTATAGAAGGGCTGAAAATAGGCCAAACCAATGTCCAGAAACCAGACAGGCACGAGGGATTTATGCTGAAGAAAAGAAAATGGC

CTTTAAAGGGCTGGCACAAG CGCTTTTTTGTCCTGGATAATGGAATGCTGAAGTATTCCAAGGCGCCACTTGAT ATCCAAAAAGGAAAAGTGCACGGG

AGCATAGATGTCGGACTGTCTGTCATGTCGATTAAAAAGAAAGCTCGGAGGATAGACCTTGACACGGAAGAGCACATCTATCATTTGAAG GTGAAATCC

CAGGACTGGTTTGACGCTTGGGTCTCCAAACTGCGCCATCACAGGTTGTACCGTCAGAATGAAATTGTGAGGTCGCCGAGAGATGCCAGTTTCCACATAT

TTCCTGCAACTTCGACAGCTGAGTCCTCCCCGGCTGCTAATGTCTCTGTTGTGGATGGAAAG ATGCAGCCCAACAGCTTTCCATGGCAGTCGCCATTAC

CATGCAGTAACAGCCTCCCTGCGACCTGCACAACTGGGCAGAGTAAAGTGGCAGCCTGGCTGCAGGACTCAGAAGAAATGGACAGGTGTGCAGAAG ATC

TTGCACACTGCCAGTCAAACCTTGTGGAACTTAGCAAGCTCCTGCAAAACTTGGAGATCCTTCAGAGAACTCAGTCGGCGCCTAACTTCACTGACATGCA

G GCTAACTGTGTAGATATTTCAAAGAAAGACAAGCGGGTCACAAGACGCTGGAGGACAAAAAGTGTCAGCAAAGATACAAAAATACAGCTCCAG GTTC

CTTTCAGCGCCACCATGTCACCCGTGCGTCTGCACTCCTCCAACCCCAACCTTTGTGCAGACATTGAGTTCCAGACCCCTCCTAGCCACCTCACCGACCC

TCTGGAAAGTTCCACGGATTATACCAAGCTACAAGAAGAATTTTGTCTAATTGCACAGAAAG TGCATTCTCTTCTGAAGTCTGCATTTAACAGCATAGC

TATAGAGAAGGAGAAGCTGAAGCAGGTGGTCTCGGAGCAAGATCACAACAAAGGCCACAGCACACAGATGGCCAGACTCCGGCAGTCACTGTCACAG GC

ACTTAACCAGAACGCTGAGCTCCGGAGTCGGCTGAACAGAATACACTCAGAGTCTACCATTTGTGATCACGTTGTCAGTGTAAATATTATCCCTAGCCCC

GATGAG CCTGGTGAGCAAATCCATGTCAGCCTCCCTCTGTCACAGCAGGTGGCCAACGAGAGCCGCCTCTCCATGTCAGAATCCGTGTCAGAATTCTTC

GATGCCCAAGAGGTGCTCCTGTCTGCAAGCTCATCAGAGAATGAG GCTTCTGATGATGAGTCCTACATCAGCGACGTGAGTGACAACATATCTGAGGAC

AACACCAGTGTCGCCGACAACATTTCTCGGCAAA TCCTGAATGGGGAGCTCACAGGAGGCGCCTTCCGCAATGGCCGTCGCACCTGCCTGCCTGCTCCT

TGCCCGGACACCAGTAACATTAACCTGTGGAATATCTTGAGGAACAACATTGGCAAAGACCTGTCGAAGGTCTCCATGCCCGTGGAACTCAACGAGCCCC

TCAACACCCTGCAGCACCTCTGTGAGGAAATGGAATACAGTGAGCTCCTGGACAAGGCCTCAGAGACCGACGACCCCTACGAGAGGATG GTTCTCGTCG

CTGCCTTTGCAGTCTCAGGGTACTGTTCCACCTACTTCCGAGCAGGAAGCAAGCCATTCAATCCGGTCCTGGGGGAGACCTATGAATGCATAAGAGAAGA

TAAGGGGTTTCGGTTCTTCTCAGAACAA GTTAGCCATCATCCACCCATTTCTGCCTGTCACTGTGAATCCAAGAATTTTGTGTTTTGGCAAG ATATCA

GATGGAAAAATAAGTTCTGGGGAAAGTCCATGGAAATCCTGCCTGTCGGAACCCTGAACGTCACGCTTCCAAA ATATGGGGATTACTATGTGTGGAATA

AAGTCACCACGTGCATACACAATATCCTGAGTGGGAGGAGATGGATCGAGCACTACGGTGAAGTGACCCTTAGAAATACCAAAAGCAGTGTTTGCATTTG

CAAACTCACGTTTGTCAAG GTGAATTACTGGAACTCCAACGTGAATGAAGTCCAGGGGGTGGTGATAGACCAGGAGGGGAAGGTGGTGCACCGGCTGTT

TGGGAAATGGCACGAAGGACTCTACTGCGGGGTGGCCCCCTCGGCAAAGTGCATCTGGAGACCAG GTTCTCTGCCAACCAACTATGAGCTCTACTATGG

CTTTACAAGATTTGCTGTGGAGCTCAATGAGTTGGACCCCGTCCTGAAGGACCTCCTTCCCCCCACAGATGCCCGATTCCGGCCAGATCAAAG GTTTTT

GGAAGAAGGGAACCTAGAAGCCGCAGCCGCAGAGAAACAAAGAGTTGAGGAACTCCAAAGATCGCGAAGACGCTACATGGAGGAAAACAACCTTGAACAT

ATACCAAAATTTTTTAA AGCTTGTGTCTGCTCAGATTTGGCCCCACTGTGGTTAGACCAAAGATGA
Translation
 - UNI34501 -  - UNI36682 -       MQPNSFPWQSPLPCSNSLPATCTTGQSKVAAWLQDSEEMDRCAED DLAHCQSNLVELSKLLQNLE

ILQRTQSAPNFTDMQ ANCVDISKKDKRVTRRWRTKSVSKDTKIQLQ VPFSATMSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLI

AQKV VHSLLKSAFNSIAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQ ALNQNAELRSRLNRIHSESTICDHVVSVNIIPSPDE PGEQIHVSLPLS

QQVANESRLSMSESVSEFFDAQEVLLSASSSENE ASDDESYISDVSDNISEDNTSVADNISRQI ILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNI

LRNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERM VLVAAFAVSGYCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQ V

SHHPPISACHCESKNFVFWQD DIRWKNKFWGKSMEILPVGTLNVTLPK KYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTLRNTKSSVCICKLTFVK 

VNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRPG GSLPTNYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQR RFLEEG

NLEAAAAEKQRVEELQRSRRRYMEENNLEHIPKFFK KACVCSDLAPLWLDQR

For any suggestions or comments, please send an email to unitrap@crg.es