Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042360 (4930433N12Rik)
Chromosomal location
Chr 9: 3133847 - 3199782 (-)
Description
RIKEN cDNA 4930433N12 gene Gene [Source:MGI Symbol;Acc:MGI:2149746]
UniGene
Mm.422774 
MGI
MGI:2149746 
Uniprot/SPTREMBL
Q9D5I9 
Human Ortholog
not available
Omim not available
UniTrap UNI31517
Vector Insertion
Chr 9: 3192819 - 3199783
Public Clones IST14307D3 (tigm) IST14150H10 (tigm) IST11731B9 (tigm) IST12458E10 (tigm)
IST14449H11 (tigm) IST10231G3 (tigm) IST14418C4 (tigm) IST13957H8 (tigm)
IST13413A4 (tigm) IST11681G11 (tigm) IST12631E6 (tigm) IST14371H7 (tigm)
IST11449C12 (tigm) IST10672A10 (tigm) IST14606C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30618
Vector Insertion
Chr 9: 3134875 - 3190806
Public Clones IST13746F8 (tigm) IST14154B9 (tigm) IST12702A2BBF1 (tigm) IST14780D8 (tigm)
IST12490C10BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048921
Sequence
AACAGTTATGAGGGCGGAACTTAGAAATGATGAAGGCGGAGCCAGGGTCTGTAGTAATTGGGCTGAGGACCGGGTTTAGGAGCGCAAAAAGTGGAGTCCA

GGAGTAGAGGAAATAGATTGAGGAAGGGGCTTGGAGCATGAGAGGCAGAGTCCTAGTGTGGAGCAACAGGACAAGCGCGGAACTTAGGCAGGCAAGAGGC

TGAGCCCAGGCCTGTGGCACCAATCTGGGGGCAGACTGTGTTGCTG - UNI31517 - GTCCACTTTGATTTCCAAAGACAGCATTGCCTTTACTGAA

GGCCAGCTACATCAAATGGCATACCACATGATCATGATGAGTTGTCCTGTGAAGGAACCGATCCATCTGCAATACAACCACTGTTTGGAAAATTCATCTT

CTTATTGAGCTTGGCTGTCTGCTACATGCTCCCTGTGGAGTGGAACATCCACAGACATTTTAAAGGAACAGCTTTGTGTCCCACCAAAG - UNI31517

 - CTCCTGGCACTACTGACTTTGGATCTGTGGGCAGTATTTGGATCAATAGCAGTATTGTTGCCGATTGAAAACTCAGGGAGACGCACACACATGTACC

CCAG - UNI30618 - GTGCTGAGGACTGAAAACATGGACTCACACATCATACATGTGTAAGCTCTCCCATCTACCACTGAGCTTCAGGTTTGTCAGC

CATCTCTCCACATACACATTAAGCATTTGAAAATAAACACTGCTGATATTGGATGATAGCAAGGTTCAGAAGACCTTCCAGAGGATTTCGAGGATCTTCT

GTCCTCAAGGAATCGATTACAGATTTCTACTTGCAGAAAAG - UNI30618 - GTCTCATTGTTGGAAGAGTGTCCTGCTGATTGGTAGGGAAGTGGC

ACCGGAGACAGAGGTGGCAACAGCAGCCAGGTGGACTGGGAGCAAGAAGAGAAGGAAAACATGTTCTCATCTCAGGAACACCCAGAACCCTTTGATGTGC

AAAAAGATTATAAGCGGCAACTTGGGGAACTTCCTCACTGGGGTAAAGTTCCTCTCTCTCCAGCAGACATCAAGTGATCAGG - UNI30618 - GCAT

TGTCCGAATGAATATCAACCATCGAGGATATCCACAGAGATCTGGGTTTAAGATCTGCTTAGGCAGAAGTGACACCAAGAGTATCATATGCTGAAACCTG

GACACAAATTGTATGGTTTAAACAACTCGGAATACACAGACTATTTTTTATTTATAGTAAACTTTTTGTGTTTG
Translation
 - UNI31517 -  - UNI31517 -  - UNI30618 - MIARFRRPSRGFRGSSVLKESITDFYLQKR - UNI30618 - RSHCWKSVLLIGRE

VAPETEVATAARWTGSKKRRKTCSHLRNTQNPLMCKKIISGNLGNFLTGVKFLSLQQTSSDQG - UNI30618 - GIVRMNINHRGYPQRSGFKICLG

RSDTKSIIC

For any suggestions or comments, please send an email to unitrap@crg.es