Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042363 (1110067D22Rik)
Chromosomal location
Chr 11: 20723585 - 20731025 (-)
Description
RIKEN cDNA 1110067D22 gene Gene [Source:MGI Symbol;Acc:MGI:1916114]
RefSeq_dna
NM_173752 
RefSeq_peptide
NP_776113.1 
UniGene
Mm.76694 
MGI
MGI:1916114 
Uniprot/SWISSPROT
Q8VED9 
Human Ortholog
ENSG00000119862 (AC008074.1)
Omim not available
UniTrap UNI18324
Vector Insertion
Chr 11: 20730130 - 20730278
Public Clones not available
Private Clones OST425670 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000047028
Sequence
TCGCTGCAGGAACATGGCGGGGTCGGTGGCCGACAGCGACGCCGTGGTG AAACTTGATGATGGGCACTTAAACAACTCCTTGGGTTCTCCAGTTCAAGC

CGACGTGTACTTCCCACGACTG - UNI18324 - ATAGTTCCATTTTGTGGGCACATTAAAGGTGGCATGAGACCAGGCAAGAAGGTATTAGTGATGG

GCATCGTAGATCTCAACCCCGAAAG CTTTGCCATCAGCTTGACCTGTGGAGACTCTGAAGATCCTCCTGCCGATGTGGCAATTGAACTCAAAGCTGTGT

TCACAGACCGGCAGCTGCTCAGAAACTCTTGTATCTCAGGAGAAAGAGGCGAGGAGCAGTCGGCAATCCCTTACTTTCCATTCATCCCAGACCAGCCGTT

CAGG GTGGAGATTCTTTGCGAGCACCCACGTTTCAGAGTGTTTGTGGATGGACACCAACTTTTTGATTTTTATCACCGTATTCAAACATTATCTGCAAT

TGACACCATAAAGATCAATGGGGACCTCCAGATCACCAAACTTGGCTGATGTTTAAAGCACTTCTATTTCAAATATGATCGATCAGGTGCCACAACTACA

TGTCTGAAAGAAGTGTCCTAACCAGATCTGGAGACTTAAAAAGAAAACAAAAACAAAGACAGACTTCACTGTCTCTTTCTGTGCAGTTTAAGTCCAGAGT

GACAACCTCATCTGTGGTTTGCCCAGAAGAAGAAAACTCGCAAGAAAGACACTGAGCCATTATACCCAGAACAAAGTAATACATTTATCTGGTTTTTATT

CAGACTAAACTAAAATGGATTTGTGATGATTTGTGATTTGATAGCAATTACTCATCATTTCAAAGCAAGGTGATATTTAGAAACAAAAGTGCTAAAGACC

TTAAAAACAACAGCGGTACATCAAATCTGCACTGACGTGGAATTGCGTAGCACAACCGACATTTTAGTCAGGGTATTTACATAGAATGTAGATTGTGCAA

GGTTTGGTTCTTATGTTTTCTTGGGTTTTGTTTTGTTTTGTTTTTGGCACAGCATCATGTTAACTTGGATTTTTAAGCATTCTCGATTAATTTATTTATA

TTTAGTATATGTATTAATGTATCAGAGAATGAGCAATGTCTACAAATTATGAACTTAGGTCTAAGGGGGAAATTTATGTATAACAAGCATAAAATAAGTG

AATTTTTACCTTAAAGAATTTGAACATATTCCCCTTACCCCTCAACTTTGGCTTCTTGACATAAATTGCTATAAGTGCTTTTGGGGACATTTTTGCAACA

CTTCGATAAAGCTCTAAAGTTCTTGTCGATGATGGGAACTTTTGTTTGCATTGCTTTTTCTCCTTCCTGTGAATTAGCACAGTATTGGCTTCCTTAAGGC

TAACTATTCCTTAGATTTACATAATAGCTCATTAAGTTGTTATTAAATTAATGGAAAGCATATAAGAGGTGATTGCATAGACAGCTTTTTAAATAACTAT

ATATCAGTTTTTAATAGTATGCTATGAAAATGGTTCCAGAATGCAGTGTTAAGCAGAAGCAAGTTGCCCCAAATTACTTACTGAGAAGTAATTTATATCA

ACCTAGGCTGTTAGCTCATTGTATACTTTGTCTTCTGAGACCCTGCCCAGTATCCCTAAGCAATGCCTTTGGAGCTTCTGAGTAGACAGTGCTGCCTCCC

TGGTGGATACGGTGGGATCCAGCTAGGTCATCTGAAAGATTAAGTCCCAGGATCTCAGCCAACAGTGACCATGCTTCCAGGGAAACTGCTTCCTGCACTT

GCAGAACCACCAGTAGGCTGCAGGTGACTAACGTATCTGCAAGGTTAGAGATGCTCGGTGTTTCATACCCTGCGTTGGTCCTAGAGAGAAGGGCCTTTGG

CATTGCTTTGGGCAGGTAGTGGGAGAAGAAAGGGATCCTGGGTGGGGTGTATTTATATATAATTTCGGTTTTGTTTGTACAGTGTATGTGTCTTATTAGG

GCACCTCTTTGTCCTTCGCTTCTAAGGTTTTTTACACAACATGCAGAGGCACTGAAGTGACCATGTCATCTTCATGTGTCAAGAATGTAGACAGTGTTTC

AGAACCAAAGTCTAAGATAAACAAAGCAAACTCAAATAAGGAATCTTTATAGATGATATATTTGGATTCTTCTCAACTTTGAAACTGTTTAGCACAGTTC

CATGGTGTTATATTCAAAGCCTTGTCCACCAAGACCTGCTGCGTCTTAAAAAACTTTCTGTTCTCATGGCTTCTCAGGCAGCCAGGAGAGCTGTTTTGTA

GCTCCAGGTTTTTATTTTGTTTTTTGTTTTTTTTAAAGCCTGTGAGCAATTTCTCATGGGTTGAAAAGCCACTTTAGAGGAGTGTCTGTCAAGAGACTTA

GAACACACCCTGAAAAACATTTATGAGATTTGGATTCGATTCATGCAGTAAGCACCCCCCCCCACCCCCCCGAGGGATCTTCTGAGTGGGCAAGCATGTG

TAACTCAGCAGAAGCTTGGGGTACGGGAGTATAAAAGATTGGAAGTGGCTTTTCTCTACCTGTCAGCTAACTCAGAAGCAGCCAATCCCGTAGGCTGCTT

GGTAATGAAAAGCAGTATTAAATCCCAGATCAGCCTCCTGGGAGCCGTCTAAGTGGTGCATTGAGTTGATTTTGGACTAGTTAATCAATAGGGGCCACAG

CCCAACTCACTGTCCAAATGGCTAGCTAGAAACTAGGACAAGTTCACAGTCTCCTCAGCCTGAGAGGTCAAATGTGGGGAATTCAGGATGGAAAGTGCAA

TTTCAAGCTTCATGGGGAAAGCACTGCATACACAGGAGTTCTGTCCACCCAGGGCCCTAGTCTTGCAATAACCAAAACCAAGGGATAACAATCAGGCTCT

GGGGCAATAAGCAGGCTTTAGACAATCTGCAGCAAAGGTGGAGGAAATGTGTCTATCTACCATGTTAACAGATGACTTCTACTTCCTGGGCAATCCCAGA

ATTGTCTTAAAATGATTATTTTTTTAAATTTTGAAGCCCAGTTTCAAATCTTGCCAACTTCTCTACAACTCCCTAAGAGATCACTCTTAGAGTTGATGAC

GCATTAAATGGCAAATCCATGTGCATTAAGAGAAAAATATCCAAAAAAGGATCAAGCCCTACTGCCTTGAGAAAACAGCTTTGGCATTTTCCAGCATTAA

TGTAAAGATAATGTTCCTATGATGACATATTTTCAAAGAAACACTTTCTTATTTACTGCGTGGTGTAAACTGTTGTTAAATGTGTTGTTACATTATGTCA

CTGCTAAAAGTTATTTGCACTATAATAAAGGAATTTTCT
Translation
MAGSVADSDAVV KLDDGHLNNSLGSPVQADVYFPRL - UNI18324 - IVPFCGHIKGGMRPGKKVLVMGIVDLNPES SFAISLTCGDSEDPPADV

AIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFR VEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG

For any suggestions or comments, please send an email to unitrap@crg.es