Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042364 (Snx18)
Chromosomal location
Chr 13: 114382393 - 114408772 (-)
Description
sorting nexin 18 Gene [Source:MGI Symbol;Acc:MGI:2137642]
RefSeq_dna
NM_130796 
RefSeq_peptide
NP_570614.2 
UniGene
Mm.408147 Mm.470707 Mm.473418 Mm.33721 
MGI
MGI:2137642 
Uniprot/SWISSPROT
Q91ZR2 
Uniprot/SPTREMBL
Q3U1H7 Q3UPB9 Q8C788 
Human Ortholog
ENSG00000178996 (SNX18)
Omim not available
UniTrap UNI11791
Vector Insertion
Chr 13: 114385071 - 114407009
Public Clones (sanger) M080E01 (ggtc) IST13094D9 (tigm) IST10123F2 (tigm) IST10123F3 (tigm)
IST13059G6 (tigm) IST10867C9HMF1 (tigm) IST10920G6 (tigm) IST14830D4 (tigm)
Private Clones OST425102 (lexicon) OST380962 (lexicon) OST348509 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037864
Sequence
ATGGCGCTGCGCGCCCGGGCGCTCTACGACTTTAAGTCCGAGAACCCCGGTGAGATCTCCCTGCGGGAGCACGAGGTGCTGAGCCTGTGCAGCGAGCAGG

ACATCGAGGGCTGGCTCGAAGGGATCAACAGCCGCGGCGACCGCGGCCTCTTCCCGGCCTCCTACGTGCAGGTGATCCGTGCGCCGGAGCCTGGCCCTCC

GGCCGACGGCGGCCCGGGAGCTCCGGCCCGCTACGCCAACGTGCCGCCCGGCGGCTTCGAGCCTCTGCCCGCCGCGCCACCCGCCGCCTTCCCGCCGCTG

CTGCAGCCGCAGGCGTCACCCGGTTCCTTCCAGCCGCCGGGCGCCGGCTTTCCCTACGGCGGGGGCGCCCTGCAGCCGTCGCCCCAGCAGCTCTACGGTG

GATACCAGGCCAGCCTGGGCAGCGACGATGACTGGGACGACGAGTGGGACGACAGCTCCACGGTGGCCGATGAGCCAGGCGCGCTGGGCAGCGGCGCGTA

CCCGGACCTCGACGGCTCGTCGTCGGCGGGCGGCGGTGCGGCCGGCCGCTACCGCCTGTCCACCCGCTCGGACCTGTCTCTGGGCTCCCGCGGCGTCTCG

GCGCCCCCG GCACCAAGCGTCTGGAGCCAAGAGCTCGGCCACGGTGAGCCGCAACCTCAATCGCTTCTCCACCTTCGTCAAGTCGGGCGGGGAGGCCTT

CGTGCTGGGAGAGGCGTCAGGCTTCGTGAAGGATGGGGACAAGCTGTGCGTGGTGCTGGGTCC TACGGCCCCGAGTGGCAGGAGAACCCCTACCCCTTC

CAGTGCACCATCGACGACCCCACCAAGCAGACCAAGTTCAAGGGCATGAAGAGCTACATCTCTTACAAGCTGGTGCCCACGCATACCCAGGTGCCCGTGC

ACAGGCGCTATAAGCACTTCGATTGGCTGTATGCGCGCCTGGCGGAGAAATTCCCAGTCATCTCGGTGCCCCATCTGCCTGAGAAGCAGGCCACCGGGCG

CTTCGAAGAGGACTTCATCTCCAAACGCAGGAAGGGTCTGATCTGGTGGATGAACCACATGGCCAGCCACCCGGTGCTGGCGCAGTGCGACGTCTTCCAG

CATTTCCTGACCTGCCCCAGCAGCACTGATGAGAAGGCCTGGAAACAGGGTAAGCGGAAGGCTGAGAAGGATGAGATGGTGGGCGCCAACTTCTTCCTCA

CTCTGAGCACCCCACCTGCCGCCGCCCTGGACCTGCAGGAGGTGGAGAGCAAGATAGATGGCTTCAAATGCTTCACCAAGAAGATGGACGACAGTGCGTT

GCAGCTCAACCACACCGCCAACGAGTTTGCGCGCAAGCAGGTGACTGGCTTCAAGAAGGAGTATCAGAAGGTGGGCCAGTCCTTCCGGGGTCTCAGCCAA

GCCTTTGAGCTGGATCAGCAGGCCTTCTCCGTGGGTCTGAATCAGGCCATTGCCTTCACTGGAGACGCCTACGACGCCATCGGCGAACTCTTCGCTGAGC

AGCCCAGGCAGGACCTGGACCCAGTCATGGACCTGTTAGCACTGTATCAGGGGCACCTGGCCAACTTCCCAGACATCATCCATGTTCAGAAAG - UNI1

1791 - GAGCTCTTACCAAAGTAAAGGAGAGTAGGCGACACGTGGAAGAAGGGAAGATGGAGGTCCAAAAAGCTGACGGCATTCAAGACCGCTGTAACA

CTATTTCCTTCGCCACGTTGGCCGAGATTCATCACTTCCATCAAATTAGAGTAAGAGACTTTAAATCACAGATGCAACATTTTTTACAACAACAAATAAT

ATTTTTCCAAAAAGTGACCCAGAAGTTGGAAGAGGCGCTTCACAAATACGACAGCGTCTAATGACTGCACATGGGACCGCGCTCTTGTTTTCAGTTGAAC

GATAATTTCCACAGCAGAACAAAACCTGCCTTCTCAGAGCTGTTGCCAACTCTAGGTGGTACAAGGACGGCTTTGTGTTCAGCCGAAACCGGCTGGATAT

ATAATTATGTAGGAAAGAAGCAGTTAATATGGCTATGTAGCAGAAACAGTACCACACTTTGTAACTAAATTATACTATGTATGCCTACACTACCATTGTA

ACTTTTGGATAATGATTATACTATTTGCCTTATTGCTTTTTGAAGTATGGGTATATTAGTGTATACTTTGTAGACCTCAAAACCCATGAAGAGTCTCAAA

GAAGCTGGCTGGATAAAAGCCTGCTGTGGATGCCTTTTTAGTCTCAGAGATCGAGACTACCTAAATCCAACCTATTCTCTGTTTACAAACTCCAACCGGA

GCAGCTATGCGACTTTGTGCCTTTAGTCCGCTTGTTTTCCTTTCTGTCCCACCTGGGTTCGAGCCCCCAACGTTTCTGATGGAAAGAGCAAAGGGCGGGC

ATGTTGGTGACAAGCCGATGACAAGCTCCCATTTCTGGGGGTGGTGGGAGAACCAGTGGCCATCACTTTGCACAGGAAGCATCGCCTGGTAAGATGCTGG

CAGTTACAGAGGCAGGAGACGCTTCTGCCGTCTCTGGATGTGAAGTCTCGTAGGGGAGAAGGCAGTGTGCCATATTCCCTCACATCTGTAGTTCACGGCC

TCGACTCAAGGGTCGCACGGATTGGGCCTGAGGATTTCGGCAGTGCCCTGAGCACGTGGAGAAGGAGGAATCCGATCGGGGATAAAGAACAGAAACAGTG

GGTGACAACGCACTCCATCTTAGTTTGGGGGAGGGTCTCCTGTCTTCCTTTTTCTTTTTTCTTTTTTCTTTTATAGCTTGAAATTTTAATGTTCAGCTTT

TTGTTTCGGTTTCAAATGGATCTACACTGTTAACTGAATGAGACTCCACTGTGATTCACTCGTTTACTTAATCAAAAAAAATTTCAGGGATGTCTGTAAA

TTTCAGTGTTGTACGCGATGAGAAGTGCTGTTGGTTGATTTAAGGAGGGACCAGAAATAATTTCTACTATTCCAGTACTGAAAGAAAAAAAAAATACTGA

TTTATACTGTTTTTAAAAACTAAGTATTGATAAAGCCCCCCTCAGAACATTTAACCTTAAAATTATTTTGAATATCGCCTTTTATTATTAGAAGGGAGCT

GCAAATGACTGACAAATACCAAAAAGATTTACATGCAGGCTTCATCTAAAAAGCACAAAGAGGTTCTGGTGTGAAATGCCCAAATCTCAACTGTTTTTTG

TAGTTGCTGAGCTAAATAATGTGATTCTTGAGTTTACAGATGTAAGAGCTGTCACTGAAGGCTGAGGTCCCTGCATCTGCTGTCCCTGTGAACTACTTCC

ACCACCCCGGAAACCCTGGTCCTGACATGGTAACGTGGGGGTACAGAGGCCAGGCTCAGAGGGGGTGAGCCACAGTTATCCGAAAGGGTCAGCTTGCAGA

AGGGTCAAGCAAGGAAAGGCGAGTGGGATAATTACTTCACAGCACATTCACTCTCTACAAAGAAATCACATATGGGTTGACATTTTAAGAACGGATGATG

ATCATTTTGACCTCTGGTCAAATCCTTGTGCTTCAGAACTCTGAGGCGGACGTGGCATCCTGTGGCGCTGTCTTTACTACAGGCACGTGGGACTGCCGCC

AAAAGCCATGCTCTCTTAAAAAGCAACTTCCTCTCTTGGATTGCAAAGTACAGCGAGATAAAGAAAACGCATATATATTTAAAAATTAATTTTATTCCAG

AATTTTGGAGGTTACAATGATAGCATTTAAGTTTGAATTGGTGTTGAAGAAGCAAGCTCTCTGCGTTTCAGATGATTTGAGCGTCCCATTTATTTGCCTC

TTTGTTTTGATGGTGGTTTGATTTTTTTTTTCTTTTAATAAAATTACTAAACTTGTGCAATAGTAGCAAGGACATCCATCACCTGAGGTGTCTGATTGTG

CTTTAGCCAGGGTGGACATAGCTTAAATCATAAACTAAGATTAAAGTCCAGAGAAGTGGAAAGCTGATGCTGCCTCCTGCTGAGATAGCGTTTGTCCTCC

CTAACCACACAGCATCATCTCACCGGCTCGTGGGACTTGACGTGAATTCTGTGGGTTAATGCACCAGGCTTACTAGTGTCCATTTTCATCCAAGATCCTT

ACTCTCTAACGTTCTTGGTCCTATTGAAGCATTTCAGTATCTAAGCATACTGCAATGTTAATACCCAAGAGAAAAGCCATTACGTACGTATTCTGGTCAC

ACGATCGGTGTGGCACCGTTTTATTTGTTACTGTTGTTGTTTTATTTTGTTGTTTCTGTTTTTTAAATAAACTATCACACCCTCC
Translation
MALRARALYDFKSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVIRAPEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFPPL

LQPQASPGSFQPPGAGFPYGGGALQPSPQQLYGGYQASLGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGGGAAGRYRLSTRSDLSLGSRGVS

APP APSVWSQELGHGEPQPQSLLHLRQVGRGGLRAGRGVRLREGWGQAVRGAGS YGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVP

VHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFF

LTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFA

EQPRQDLDPVMDLLALYQGHLANFPDIIHVQKG - UNI11791 - GALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFK

SQMQHFLQQQIIFFQKVTQKLEEALHKYDSV
Transcript ENSMUST00000109241
Sequence
CGAGTTGCAGTCGCTGCTGCGAGCCGAGCCGAGCTGCACGGAGGGCGAGAGCGGAGCGGGGAGCGGACCGGTGCGCTGCCCTCCAGGCTTCCCTTCGGCG

TTCGGGGGGGGGATCCTGACTGCAGGGGCCCTCGGACCGGCCCGAGCTCGGGGCGCCGGGCTCGGGACCATGGCGCTGCGCGCCCGGGCGCTCTACGACT

TTAAGTCCGAGAACCCCGGTGAGATCTCCCTGCGGGAGCACGAGGTGCTGAGCCTGTGCAGCGAGCAGGACATCGAGGGCTGGCTCGAAGGGATCAACAG

CCGCGGCGACCGCGGCCTCTTCCCGGCCTCCTACGTGCAGGTGATCCGTGCGCCGGAGCCTGGCCCTCCGGCCGACGGCGGCCCGGGAGCTCCGGCCCGC

TACGCCAACGTGCCGCCCGGCGGCTTCGAGCCTCTGCCCGCCGCGCCACCCGCCGCCTTCCCGCCGCTGCTGCAGCCGCAGGCGTCACCCGGTTCCTTCC

AGCCGCCGGGCGCCGGCTTTCCCTACGGCGGGGGCGCCCTGCAGCCGTCGCCCCAGCAGCTCTACGGTGGATACCAGGCCAGCCTGGGCAGCGACGATGA

CTGGGACGACGAGTGGGACGACAGCTCCACGGTGGCCGATGAGCCAGGCGCGCTGGGCAGCGGCGCGTACCCGGACCTCGACGGCTCGTCGTCGGCGGGC

GGCGGTGCGGCCGGCCGCTACCGCCTGTCCACCCGCTCGGACCTGTCTCTGGGCTCCCGCGGCGTCTCGGCGCCCCCGGCGCACCAAGCGTCTGGAGCCA

AGAGCTCGGCCACGGTGAGCCGCAACCTCAATCGCTTCTCCACCTTCGTCAAGTCGGGCGGGGAGGCCTTCGTGCTGGGAGAGGCGTCAGGCTTCGTGAA

GGATGGGGACAAGCTGTGCGTGGTGCTGGGTCCCTACGGCCCCGAGTGGCAGGAGAACCCCTACCCCTTCCAGTGCACCATCGACGACCCCACCAAGCAG

ACCAAGTTCAAGGGCATGAAGAGCTACATCTCTTACAAGCTGGTGCCCACGCATACCCAGGTGCCCGTGCACAGGCGCTATAAGCACTTCGATTGGCTGT

ATGCGCGCCTGGCGGAGAAATTCCCAGTCATCTCGGTGCCCCATCTGCCTGAGAAGCAGGCCACCGGGCGCTTCGAAGAGGACTTCATCTCCAAACGCAG

GAAGGGTCTGATCTGGTGGATGAACCACATGGCCAGCCACCCGGTGCTGGCGCAGTGCGACGTCTTCCAGCATTTCCTGACCTGCCCCAGCAGCACTGAT

GAGAAGGCCTGGAAACAGGGTAAGCGGAAGGCTGAGAAGGATGAGATGGTGGGCGCCAACTTCTTCCTCACTCTGAGCACCCCACCTGCCGCCGCCCTGG

ACCTGCAGGAGGTGGAGAGCAAGATAGATGGCTTCAAATGCTTCACCAAGAAGATGGACGACAGTGCGTTGCAGCTCAACCACACCGCCAACGAGTTTGC

GCGCAAGCAGGTGACTGGCTTCAAGAAGGAGTATCAGAAGGTGGGCCAGTCCTTCCGGGGTCTCAGCCAAGCCTTTGAGCTGGATCAGCAGGCCTTCTCC

GTGGGTCTGAATCAGGCCATTGCCTTCACTGGAGACGCCTACGACGCCATCGGCGAACTCTTCGCTGAGCAGCCCAGGCAGGACCTGGACCCAGTCATGG

ACCTGTTAGCACTGTATCAGGGGCACCTGGCCAACTTCCCAGACATCATCCATGTTCAGAAAG - UNI11791 - GAGCTCTTACCAAAGTAAAGGAG

AGTAGGCGACACGTGGAAGAAGGGAAGATGGAGGTCCAAAAAGCTGACGGCATTCAAGACCGCTGTAACACTATTTCCTTCGCCACGTTGGCCGAGATTC

ATCACTTCCATCAAATTAGAGTAAGAGACTTTAAATCACAGATGCAACATTTTTTACAACAACAAATAATATTTTTCCAAAAAGTGACCCAGAAGTTGGA

AGAGGCGCTTCACAAATACGACAGCGTCTAATGACTGCACATGGGACCGCGCTCTTGTTTTCAGTTGAACGATAATTTCCACAGCAGAACAAAACCTGCC

TTCTCAGAGCTGTTGCCAACTCTAGGTGGTACAAGGACGGCTTTGTGTTCAGCCGAAACCGGCTGGATATATAATTATGTAGGAAAGAAGCAGTTAATAT

GGCTATGTAGCAGAAACAGTACCACACTTTGTAACTAAATTATACTATGTATGCCTACACTACCATTGTAACTTTTGGATAATGATTATACTATTTGCCT

TATTGCTTTTTGAAGTATGGGTATATTAGTGTATACTTTGTAGACCTCAAAACCCATGAAGAGTCTCAAAGAAGCTGGCTGGATAAAAGCCTGCTGTGGA

TGCCTTTTTAGTCTCAGAGATCGAGACTACCTAAATCCAACCTATTCTCTGTTTACAAACTCCAACCGGAGCAGCTATGCGACTTTGTGCCTTTAGTCCG

CTTGTTTTCCTTTCTGTCCCACCTGGGTTCGAGCCCCCAACGTTTCTGATGGAAAGAGCAAAGGGCGGGCATGTTGGTGACAAGCCGATGACAAGCTCCC

ATTTCTGGGGGTGGTGGGAGAACCAGTGGCCATCACTTTGCACAGGAAGCATCGCCTGGTAAGATGCTGGCAGTTACAGAGGCAGGAGACGCTTCTGCCG

TCTCTGGATGTGAAGTCTCGTAGGGGAGAAGGCAGTGTGCCATATTCCCTCACATCTGTAGTTCACGGCCTCGACTCAAGGGTCGCACGGATTGGGCCTG

AGGATTTCGGCAGTGCCCTGAGCACGTGGAGAAGGAGGAATCCGATCGGGGATAAAGAACAGAAACAGTGGGTGACAACGCACTCCATCTTAGTTTGGGG

GAGGGTCTCCTGTCTTCCTTTTTCTTTTTTCTTTTTTCTTTTATAGCTTGAAATTTTAATGTTCAGCTTTTTGTTTCGGTTTCAAATGGATCTACACTGT

TAACTGAATGAGACTCCACTGTGATTCACTCGTTTACTTAATCAAAAAAAATTTCAGGGATGTCTGTAAATTTCAGTGTTGTACGCGATGAGAAGTGCTG

TTGGTTGATTTAAGGAGGGACCAGAAATAATTTCTACTATTCCAGTACTGAAAGAAAAAAAAAATACTGATTTATACTGTTTTTAAAAACTAAGTATTGA

TAAAGCCCCCCTCAGAACATTTAACCTTAAAATTATTTTGAATATCGCCTTTTATTATTAGAAGGGAGCTGCAAATGACTGACAAATACCAAAAAGATTT

ACATGCAGGCTTCATCTAAAAAGCACAAAGAGGTTCTGGTGTGAAATGCCCAAATCTCAACTGTTTTTTGTAGTTGCTGAGCTAAATAATGTGATTCTTG

AGTTTACAGATGTAAGAGCTGTCACTGAAGGCTGAGGTCCCTGCATCTGCTGTCCCTGTGAACTACTTCCACCACCCCGGAAACCCTGGTCCTGACATGG

TAACGTGGGGGTACAGAGGCCAGGCTCAGAGGGGGTGAGCCACAGTTATCCGAAAGGGTCAGCTTGCAGAAGGGTCAAGCAAGGAAAGGCGAGTGGGATA

ATTACTTCACAGCACATTCACTCTCTACAAAGAAATCACATATGGGTTGACATTTTAAGAACGGATGATGATCATTTTGACCTCTGGTCAAATCCTTGTG

CTTCAGAACTCTGAGGCGGACGTGGCATCCTGTGGCGCTGTCTTTACTACAGGCACGTGGGACTGCCGCCAAAAGCCATGCTCTCTTAAAAAGCAACTTC

CTCTCTTGGATTGCAAAGTACAGCGAGATAAAGAAAACGCATATATATTTAAAAATTAATTTTATTCCAGAATTTTGGAGGTTACAATGATAGCATTTAA

GTTTGAATTGGTGTTGAAGAAGCAAGCTCTCTGCGTTTCAGATGATTTGAGCGTCCCATTTATTTGCCTCTTTGTTTTGATGGTGGTTTGATTTTTTTTT

TCTTTTAATAAAATTACTAAACTTGTGCAATAGTAGCAAGGACATCCATCACCTGAGGTGTCTGATTGTGCTTTAGCCAGGGTGGACATAGCTTAAATCA

TAAACTAAGATTAAAGTCCAGAGAAGTGGAAAGCTGATGCTGCCTCCTGCTGAGATAGCGTTTGTCCTCCCTAACCACACAGCATCATCTCACCGGCTCG

TGGGACTTGACGTGAATTCTGTGGGTTAATGCACCAGGCTTACTAGTGTCCATTTTCATCCAAGATCCTTACTCTCTAACGTTCTTGGTCCTATTGAAGC

ATTTCAGTATCTAAGCATACTGCAATGTTAATACCCAAGAGAAAAGCCATTACGTACGTATTCTGGTCACACGATCGGTGTGGCACCGTTTTATTTGTTA

CTGTTGTTGTTTTATTTTGTTGTTTCTGTTTTTTAAATAAACTATCACACCCTCC
Translation
MALRARALYDFKSENPGEISLREHEVLSLCSEQDIEGWLEGINSRGDRGLFPASYVQVIRAPEPGPPADGGPGAPARYANVPPGGFEPLPAAPPAAFPPL

LQPQASPGSFQPPGAGFPYGGGALQPSPQQLYGGYQASLGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGGGAAGRYRLSTRSDLSLGSRGVS

APPAHQASGAKSSATVSRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKLVPTHTQVPV

HRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFL

TLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAE

QPRQDLDPVMDLLALYQGHLANFPDIIHVQKG - UNI11791 - GALTKVKESRRHVEEGKMEVQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKS

QMQHFLQQQIIFFQKVTQKLEEALHKYDSV

For any suggestions or comments, please send an email to unitrap@crg.es