Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042453 (Reln)
Chromosomal location
Chr 5: 21390272 - 21850523 (-)
Description
reelin Gene [Source:MGI Symbol;Acc:MGI:103022]
RefSeq_dna
NM_011261 
RefSeq_peptide
NP_035391.2 
UniGene
Mm.402938 Mm.425236 
MGI
MGI:103022 
Uniprot/SWISSPROT
Q60841 
Uniprot/SPTREMBL
A1IH02 Q8CBK6 Q64FW1 Q8C978 Q148P9 
Human Ortholog
ENSG00000189056 (RELN)
Omim 257320 - LISSENCEPHALY 2  
UniTrap UNI34944
Vector Insertion
Chr 5: 21660762 - 21677099
Public Clones IST10655D1 (tigm) IST13358A5 (tigm) IST13985H9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061408
Sequence
ATGAGAGAGCGCGCGGGGCGCGCGGCGGCACGG CGCGGCGGCATGGAGCGCGGCTGCTGGGCGCCGCGGGCTCTCGTCCTGGCCGTGCTGCTGCTGCTG

GCGACGCTGAGGGCGCGCGCGGCCACCGGCTACTACCCGCGCTTCTCGCCTTTCTTTTTCCTGTGCACCCACCACGGGGAGCTGGAAGGGGATGGGGAGC

AGGGCGAGGTGCTCATTTCCCTGCACATTGCGGGCAACCCCACCTACTACGTACCGGGACAGGAATACCATG GGGCCAGCCGGCCGGAGACCGGGACAA

CCTCCTACCTCAGCGGGGTGCGCTGCCTGGGGAGAGAGAACAAAGTTAGTGGAGAATGGAGTCCTGAGTTGGGATTTCAACTGTCCCCTAACACATAAAC

TGGTGCTTATGTGACAGGCCACACAAGCTTTTGGTACTGCTGTCCCCCACCCCTTCACTCCCTGCAGCTGCCGAACCTGCGCATCGTGTTTTCCTAACCC

CAGTACTTAGATACCAGACTTTTGTCCTGTTCTGGGTCCTCCTTGGTGGGTCCCCAGGTGGCGCTGGGGTTGTCACTGGGTTTTGCCGGCCAGCTGCCGA

CAGATTGGAGCACTTTGGTCGGTGGCTGCCCATGCCGGCGGCCAGTTAAAAGTTCCCGCTGCTCTGCAGCCAGGAGTCCCTAGTGATCTGTCCTCAAGAA

ACAGAGCGGCTGTTTCCAACCCTTTATTCTTTTAAAGAGTCGTTTAAAATATCAGTGATTGATGATTTCTGTCATCCCCTTCATACTTTTAGCTTGGTGC

TTGCTGTTGTTAGCATTGTCTGGGCGATGCTTACTAATCACTTGTATCTGCACAGCTTTAAGTCCCTGGCAGGACCTACAAGCTTCTCCCCACAAAGGCG

ATCCCTCTCCTAAGGGATCAGTATGCAATCCTTCATCGAGGTGAAACATTACTGCAAAGTTGAATTTTAGCAACAAGAAGAGTAATTTAATGTAGTATGC

AGTCCTTCATCGAGGTTAAAACATTACTCAAAAATAAAAATTAGCTACAAGAAGAGCAATTTAGTGTAGTCCATATACTTTTAATCAAGTGAAATATGTG

GGAGATAAACCATGTGTACTTTCTGTCTTCATTCTGGGACTTCTTAATGATAGGAAATGTTAAATTGGAAAATTTCCATAAAATATTTATACCCAATGAC

ATAAACTATCATTGAGTGAACTCATGCCATCCCAAGGGTGCTGTCTGTAATAGGCTACAGGTGTTGACAGAGCAGAAGGTGGCTGGCATTTCACATAGAT

TTGGGAGTGAAAATTTTGTAAAAATGCTAAAGAGTTTTCTGTTTCAGTAAAACCTTCCTACCCACCTCCAAATGGCTTTGGCTGAGTCTGTTCATCCTAG

ATATTTACACCAGTGGCTTTAACAACTTCCTCAGAGGGGTGGCAGCCTTGTTCCTGCAATTTCATAATTTAATTTTAGGAAATCAATTTCTGTAACTAGT

CCTTTAAATAAAAGGGTTTGCTTGTACGTGTTCCCTTCCCAACAGTTATCTGGTGCTTTTTCTGAGATCATGGAAATCTTTGCAGTGAAAGGAACGCCAG

TGTGGTGACCACCCAGACCTAACCTACAGACTGACTGAGACAGTGGTCACTTGGCGTGCCCCTTAGCAGACGTGTAGCTGGTTATCTGTGAGAGCCGCTA

GTCGGTGAGTGAGTGAATGCTGGTCTAAAAGGTGCTCCTGTCAAGCTGTGAGGGGTGTCTCTGATGACAGAGCCGCATCAGCCCCCACCACACAGACCCT

TTGTACATCACTGCTGAAGGGAGTATCAGTGAGACTGAGAATAACCATCTACAGCTTTTGGGTTTGCTGTAAAGTTGGCAGATGAACCACAGCCTGACTG

CAGTCATGTCACTAAGCCTGAAAAGAGGGGAATGAATGCATTCTTTCAGACTGGACATTGTAGGGAACAGGTCCCCAGAACCTCTCTTATGCCACCAGAA

AAGATGGAGGGATTTTATCATGTAACTTGAAAGGTCAAATTATTAGAGTAATGCCATTTTAAATTCCTATTAAATATTGTATCAAAGTTTAAGCTTTGGG

AACCAGCTGTATAACTCTAGGCCTTCAGTGTTTTTCCTATAAAATGCTCTACAGGTAGGAGAAATGCTTAAAACTGAAATTATACATATATGTGGCTTTT

TAATTATTAAACCTTTGGAAATGAAAAAAATAGCATCTGTAAGAATTGACTCACTATAGGAAAACATAATAAATACATTTGTGGTTGACTCATTTTGATG

AATGTTG
Translation
MRERAGRAAAR RGGMERGCWAPRALVLAVLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAGNPTYYVPGQEYHG GASRPET

GTTSYLSGVRCLGRENKVSGEWSPELGFQLSPNT
Transcript ENSMUST00000115152
Sequence
CCCAAGCCCGGCCGAGGGGCGTCGCGTGCACACCGGCGGCGGCGGCGCTCGGAGGCGGACGACGCGCTCTCGGCGCCCGCGGCCCCGGTTCCCCCCGCGC

TCTCGCTCCGGCGGCCCAAAGTAACTTCGGGAGCCTCGGTCTCCCGCTAACTTCCCCCCGCGGGCTCGGTTGCCCGGACCCGCTCGGCTCGAGCCCGCCG

CCGGCTCGCCTTCCCCGCACGCGGCTCCTCCGTGCCGGTGCCTCCGAAAGTGGATGAGAGAGCGCGCGGGGCGCGCGGCGGCACGGAGCGCGGCGGCATG

GAGCGCGGCTGCTGGGCGCCGCGGGCTCTCGTCCTGGCCGTGCTGCTGCTGCTGGCGACGCTGAGGGCGCGCGCGGCCACCGGCTACTACCCGCGCTTCT

CGCCTTTCTTTTTCCTGTGCACCCACCACGGGGAGCTGGAAGGGGATGGGGAGCAGGGCGAGGTGCTCATTTCCCTGCACATTGCGGGCAACCCCACCTA

CTACGTACCGGGACAGGAATACCATG TTACAATTTCAACAAGCACCTTCTTTGATGGCTTGCTGGTGACGGGACTCTATACCTCGACAAGCATCCAGTC

TTCTCAGAGCATTGGAGGCTCCAGCGCCTTTGGATTCG GGATCATGTCCGACCACCAGTTTGGTAACCAGTTTATGTGCAGTGTGGTGGCCTCTCATGT

GAGTCACCTGCCTACAACCAACCTCAGCTTTGTCTGGATTGCCCCACCAGCTGGCACAGGCTGTGTGAATTTCAT - UNI34944 - GGCTACTGCAA

CACATAGGGGCCAGGTGATTTTCAAAGACGCACTGGCCCAGCAGCTGTGTGAACAAGGAG - UNI34944 - CTCCCACAGAGGCCACTGCTTACTCG

CACCTTG - UNI34944 - CTGAAATACACAGTGACAGTGTGATCCTACGAGATGACTTTGACTCCTACCAGCAACTGGAATTGAACCCCAACATATG

 GGTTGAATGCAGCAACTGTGAGATGGGAGAGCAGTGTGGCACCATCATGCATGGCAATGCTGTCACCTTCTGTGAGCCGTACGGCCCTCGAGAGCTG A

CCACCACATGCCTGAACACAACAACAGCATCTGTCCTCCAGTTTTCCATTG GGTCAGGATCATGTCGATTTAGTTACTCTGACCCCAGCATCACTGTGT

CATACGCCAAGAACAATACCGCTGATTGGATTCAGCTGGAGAAAATTAG AGCCCCTTCCAATGTGAGCACAGTCATCCACATCCTGTACCTCCCCGAGG

AAGCCAAAGGGGAGAGCGTGCAGTTCCAGTGGAAACAGGACAGCCTGCGAGTGGGTGAGGTGTATGAGGCCTGCTGGGCCCTGGATAACATCCTGGTCAT

CAATTCAGCCCACAGAGAAGTCGTTCTGGAGGACAACCTCGACCCGGTCGACACGGGCAACTGGCTCTTCTTCCCTGGAGCAACGGTCAAG CATAGCTG

TCAGTCAGATGGGAACTCCATTTATTTCCATGGAAATGAAGGCAGCGAGTTCAATTTTGCCACCACCCGGGATGTAGATCTTTCTACAGAGGATATTCAA

GAGCAGTGGTCAGAAGAATTTGAGAGCCAGCCCACAGG ATGGGATATCTTGGGAGCAGTAGTTGGTGCAGACTGTGGAACCGTAGAATCAGGACTATCA

CTGGTGTTCCTCAAAGATGGAGAGAGGAAGCTTTGCACCCCCTACATGGATACAACTGGTTATGGCAACCTGAGGTTCTACTTCGTTATGG GAGGAATC

TGTGACCCTGGAGTCTCTCATGAAAACGATATCATCTTATATGCAAAGATTGAAGGAAGAAAAGAACACATTGCACTGGACACTCTTACCTATTCTTCCT

ATAAG GTTCCGTCTTTGGTTTCTGTGGTCATCAACCCTGAACTTCAGACACCTGCCACCAAATTTTGTCTCAGGCAAAAGAGCCACCAAGGGTATAATC

GGAATGTCTGGGCTGTGGACTTCTTCCATGTGCTGCCCGTTCTCCCTTCAACAATGTCTCACATGATCCAGTTTTCTATTAATTTGGGATGCGGCACACA

CCAGCCTGGGAACAG CGTCAGCTTGGAGTTTTCTACTAACCATGGACGGTCCTGGTCCCTACTCCACACTGAGTGCTTGCCGGAGATCTGTGCAGGCCC

CCACCTCCCCCACAGCACTGTCTACTCCTCAGAAAACTACAGCGG GTGGAACCGAATCACGATTCCTCTCCCTAATGCAGCACTCACCCGAGACACCAG

GATTCGCTGGAGACAAACAGGCCCAATCCTGGGAAATATGTGGGCAATTGATAATG TTTATATAGGTCCTTCGTGTCTCAAATTCTGTTCTGGCAGAGG

ACAATGCACTCGGCATGGCTGCAA GTGTGACCCAGGATTTTCTGGCCCAGCTTGTGAGATGGCATCTCAGACATTCCCAATGTTTATTTCGGAAAGCTT

TGGCAGTGCCAGACTTTCCTCTTACCATAACTTTTACTCTATCCGTGGTGCTGAAGTCAGCTTTGGTTGTGGTGTCTTAGCCAGTGGTAAGGCTCTGGTT

TTCAACAAAGATGGGAGGCGGCAGCTAATCACGTCCTTTCTGGACAGCTCGCAGTCCAG GTTTCTTCAGTTTACACTGAGGCTGGGGAGCAAGTCTGTG

CTGAGCACGTGCAGAGCCCCTGACCAGCCGGGGGAGGGAGTCCTGCTGCACTATTCATATGACAACGGGATAACATGGAAACTCCTGGAGCACTATTCCT

ACGTCAACTACCACGAGCCCAG AATAATCTCTGTAGAGCTACCGGATGATGCAAGACAGTTTGGAATCCAGTTCAGATGGTGGCAGCCTTACCATTCTT

CCCAAGGAGAAGACGTGTGGGCCATTGATGAGATTGTCATGACCTCAGTCCTGTTCAACAGCATCAGTCTCGACTTTACCAATCTTGTGGAAGTCACTCA

ATCCCTGGGATTCTACCTTGGCAATGTTCAACCATACTGTGGCCATGACTGGACGCTTTG TTTTACGGGAGATTCTAAACTTGCCTCAAGCATGCGCTA

TGTGGAAACACAGTCCATGCAGATCGGAGCATCCTATATGATTCAGTTCAGCCTAGTGATGGGATGTGGCCAGAAATACACTCCTCACATGGACAACCAG

GTGAAGCTGGAGTACTCAGCCAACCACGGCCTTACATGGCACCTTGTACAAGAA GAATGCCTTCCCAGTATGCCAAGCTGCCAGGAATTTACATCTGCC

AGCATTTACCATGCCAGCGAGTTCACACAGTGGAGAAGAGTCACTGTTGTTCTTCCCCAGAAAACATG GTCCGGTGCCACCCGCTTCCGTTGGAGTCAG

AGCTATTACACAGCCCAGGATGAGTGGGCTTTAGACAACATTTACATTGGGCAGCAGTGCCCCAACATGTGCAGTGGGCATGGCTCATGTGACCATGGCG

TGTGCAG GTGTGACCAGGGATACCAGGGCACTGAATGCCACCCAGAAGCTGCACTTCCTTCCACGATTATGTCAGATTTTGAGAACCCGAGCAGTTGGG

AATCAGACTGGCAGGAAGTTATTGGGGGAGAAGTTGTAAAGCCTGAGCAAGGCTGTGGAGTCGTGTCTTCTGGATCTTCTCTGTACTTCAGCAAG GCTG

GGAAGAGGCAGCTGGTGAGCTGGGACCTGGACACATCCTGGGTGGACTTTGTCCAGTTCTACATCCAGATAGGAGGAGAGAGTGCTGCATGCAACAAGCC

TGACAGCAGAGAGGAGGGCATTCTGCTCCAGTATAGCAACAACGGGGGCATCCAGTGGCACCTGCTGGCAGAGATGTACTTCTCAGACTTCAGCAAACCC

AG ATTTGTCTACCTGGAGCTCCCAGCTGCTGCGAAGACCCCTTGTACCAGGTTCCGCTGGTGGCAGCCTGTGTTCTCGGGGGAGGACTATGACCAGTGG

GCCGTTGATGATATCATCATTCTGTCAGAGAAGCAGAAGCAGGTTATTCCAGTTGTCAACCCAACTTTGCCCCAG AACTTCTATGAGAAGCCAGCTTTC

GATTACCCTATGAACCAAATGAGTGTGTGGCTAATGTTGGCCAATGAAGGCATGGCTAAAAACGACAGCTTCTGTGCGACCACGCCGTCAGCCATGGTGT

TTGGAAAGTCAGATGGAGACCGGTTTGCAGTAACTCGAGATCTGACCCTGAAACCTGGATATGTGCTGCAGTTCAAG CTAAACATAGGCTGCACCAGCC

AGTTCAGCAGCACTGCCCCGGTTCTCCTGCAGTATTCACATGATGCCGGCATGTCGTGGTTTCTGGTGAAGGAAGGATGCTTCCCAGCGTCAGCAGGCAA

AGGATGTGAAGGGAACTCCAGGGAATTGAGTGAGCCTACTGTCTATTATACTGGGGACTTCGAAGAATGGACTAGAATCACCATTGCCATTCCAAGGTCC

CTTGCATCCAG CAAGACCAGATTCCGATGGATCCAAGAGAGCAGCTCTCAGAAGAATGTGCCCCCGTTTGGCTTAGATGGGGTGTACATATCTGAGCCT

TGTCCCAGTTACTGCAGTGGCCATGGAGACTGCATCTCGGGGGTGTGTTTTTGTGACCTGGGGTACACAG CTGCACAAGGAACCTGTGTGTCAAACACC

CCTAACCACAGTGAGATGTTCGACAGGTTTGAGGGGAAGCTAAGCCCACTGTGGTACAAAATCACCGGGGGTCAGGTTGGCACGGGCTGTGGCACCCTCA

ATGACGGCAGGTCCCTCTACTTTAATGGCCTTGGGAAAAGGGAAGCCAGGACAGTCCCACTGGACACCAGGAATATCAG ACTTGTTCAGTTTTATATAC

AAATTGGAAGTAAAACATCAGGGATTACGTGCATCAAACCACGGGCTAGAAATGAGG GGCTTGTTGTTCAGTATTCCAATGATAATGGGATACTTTGGC

ATTTGCTGAGAGAGTTGGATTTCATGTCATTCCTGGAGCCACAGATCATTTCCATTGACCTGCCCCGGGAAGCAAAGACACCTGCCACAGCTTTCCGGTG

GTGGCAGCCGCAGCATG GGAAGCATTCGGCCCAGTGGGCTTTGGATGATGTCCTTATAGGAGTGAATGACAGCTCTCAAACTGGATTTCAAGATAAATT

TGATGGCTCCATAGACTTGCAAGCCAACTGGTATCGAATCCAGGGAGGCCAAGTTGATATCGACTGCCTCTCTATGGACACTGCCCTTATATTCACTGAA

AACATAG GAAAACCTCGCTATGCTGAGACCTGGGACTTCCATGTGTCAGCGTCAAGCTTCTTACAGTTTGAAATGAACATGGGCTGCAGCAAGCCTTTC

AGTGGTGCCCACGGCATACAGCTCCAGTACTCTCTGAACAACGGCAAGGACTGGCAGCTTGTCACCGAAGAGTGTGTCCCTCCAACCATTGGCTGCGTGC

ACTACACAGAGAGTTCAACTTACACATCAGAAAGATTCCAGAACTGGAGGCGGGTCACGGTCTACCTGCCACTCGCCACCAA TTCTCCCAGGACTCGGT

TCAGATGGATTCAGACCAACTATACTGTTGGAGCAGATTCCTGGGCTATTGATAATGTCATCCTGGCCTCGGGCTGTCCTTGGATGTGCTCAGGACGAGG

GATCTGTGATTCGGGGCGCTGTGT GTGTGACCGGGGCTTCGGTGGACCCTTCTGTGTTCCTGTTGTTCCTCTTCCCTCCATTCTAAAAGATGATTTCAA

TGGGAACTTACATCCTGACCTTTGGCCTGAAGTGTACGGGGCAGAGAGGGGCAATCTGAATGGCGAAACCATCAAATCCGGAACATGTCTGATCTTTAAA

GGG GAGGGACTAAGAATGCTTATTTCCAGAGATCTAGATTGCACCAATACTATGTATGTCCAGTTCTCTCTCCGATTTATAGCGAAAG GTACCCCAGA

GAGGTCTCACTCCATCCTTCTACAGTTCTCTGTCAGTGGAGGAGTCACCTGGCACCTGATGGATGAATTCTACTTCCCTCAAACGACCAGCATACTTTTC

ATCAATGTTCCCTTACCATACGGTGCCCAAACCAACGCTACAAGATTCAGACTCTGGCAACCGTACAATAATG GTAAGAAAGAAGAAATCTGGATCATT

GATGACTTTATTATTGATGGAAACAATTTGAACAACCCCGTGCTGCTGCTGGACACGTTCGACTTTGGGCCCAGGGAAGACAATTGGTTTTTCTATCCGG

GTGGTAATATCGGACTTTACTGCCCGTATTCTTCAAAGGGAGCTCC TGAGGAGGATTCGGCCATGGTGTTTGTTTCAAACGAAGTTGGAGAACACTCCA

TTACCACACGAGACCTAAGTGTGAACGAGAACACCATCATTCAATTTGAG ATCAATGTTGGCTGCTCCACTGATAGTTCTTCTGCTGATCCGGTCAGAC

TGGAATTCTCAAGGGACTTTGGAGCCACCTGGCACCTGCTGCTGCCTCTCTGCTACCACAGCAGCAGCCTCGTCAGCTCCTTATGCTCCACTGAGCATCA

CCCGAGCAGCACCTACTACGCGGGGACCACCCAGGGCTGGCGGCGGGAGGTCGTGCACTTCGGAAAGCTGCACCTTTGTGG ATCTGTGCGTTTCCGTTG

GTACCAGGGATTTTATCCTGCTGGCTCTCAGCCGGTCACATGGGCCATTGACAATGTCTACATTGGTCCCCAGTGTGAAGAGATGTGCTATGGGCACGGG

AGCTGCATCAATGGAACCAAGTGTATATGTGACCCGGGCTACTCTGGGCCAACCTGTAAAATAAGCACCAAAAATCCTGATTTTCTCAAAGACGACTTTG

AAG GTCAACTGGAATCCGATCGATTCTTACTGATGAGCGGTGGGAAGCCGTCTCGTAAGTGTGGCATCCTTTCCAGTGGGAACAACCTCTTCTTCAATG

AGGACGGCTTGCGCATGCTAGTAACACGGGACCTGGATTTATCACATGCAAG GTTTGTGCAGTTCTTCATGAGACTGGGATGTGGTAAAGGTGTTCCAG

ACCCCAGGAGCCAGCCCGTGCTTCTGCAGTACTCCCTCAATGGCGGCCTCTCCTGGAGTCTTCTTCAAGAGTTCCTCTTCAGCAACTCCAGCAATGTGGG

CAGGTACATTGCCCTGGAAATGCCCCTGAAAGCCCGTTCTGGTTCGACACGCCTCCGCTGGTGGCAGCCATCTGAAAATGGGCACTTCTATAGCCCCTGG

GTGATCGACCAG ATTCTTATTGGAGGAAATATCTCTGGTAATACAGTCTTAGAAGATGATTTCTCAACTCTGGACAGCAGAAAGTGGCTGCTTCACCCA

GGAGGCACCAAGATGCCTGTGTGTGGCTCCACAGGCGATGCCCTGGTCTTTATTGAAAAGGCCAGCACCCGTTACGTGGTCACGACAGACATCGCTGTGA

ATGAGGACTCATTCCTACAGATAGACTTTGCTGCCTCCTGCTCAGTCACAGACTCCTGCTATG CTATTGAACTGGAGTACTCGGTGGATCTCGGTCTGT

CGTGGCACCCGCTGGTGAGGGACTGCCTGCCTACCAATGTTGAGTGTAGTCGTTACCACCTGCAGCGGATCCTGGTGTCAGATACTTTCAACAAGTGGAC

CAGAATCACTCTGCCCCTGCCTTCCTACACCAG GTCTCAAGCCACTCGTTTCCGCTGGCATCAGCCAGCGCCTTTTGACAAGCAGCAGACCTGGGCAAT

AGATAATGTCTATATTGGGGATGGTTGCCTAGACATGTGCAGTGGCCACGGGAGATGCGTCCAGGGAAGCTGTGT CTGTGATGAACAGTGGGGAGGCCT

GTACTGTGATGAGCCTGAGACCTCCCTTCCCACCCAGCTCAAAGACAACTTCAACCGAGCCCCCTCCAACCAGAACTGGCTGACTGTGAGCGGTGGGAAG

CTGAGTACAGTGTGTGGGGCTGTGGCTTCCGGCCTGGCTCTCCATTTCAGTGGG GGCTGCAGCCGATTGTTAGTCACTGTGGATCTGAACCTCACCAAT

GCTGAGTTTATCCAGTTTTACTTTATGTATGGATGCCTCATTACGCCGAGCAACCGTAACCAGGGAGTCCTGCTGGAGTACTCTGTCAATGGAGGCATCA

CCTGGAACTTGCTGATGGAGATTTTCTATGACCAGTACAGCAAACCTGG ATTTGTGAATATCCTTCTCCCTCCTGATGCTAAAGAGATTGCCACTCGCT

TCCGATGGTGGCAGCCACGACATGATGGCCTTGACCAGAATGACTGGGCCATTGACAATGTCCTCATCTCGGGCTCTGCGGACCAGAGGACAGTCATGCT

GGACACCTTTAGCAGCGCCCCAGTACCACAGCATGAGCGCTCCCCCGCAGACGCTGGCCCTGTTGGAAGAATTGCTTTTGAAATGTTCTTAGAAGACAAA

ACTTCAG TGAATGAGAATTGGCTCTTCCATGATGACTGTACAGTGGAAAGATTCTGTGACTCGCCAGATGGTGTCATGCTCTGTGGCAGCCATGATGGA

CGAGAGGTGTATGCAGTGACTCATGACCTGACGCCCACTGAGAACTGGATCATGCAGTTCAAG ATCTCTGTTGGATGCAAAGTGCCTGAAAAAATTGCC

CAGAATCAAATTCACGTGCAGTTTTCTACTGACTTTGGCGTGAGCTGGAGTTATTTAGTCCCTCAGTGCTTACCCGCCGACCCAAAGTGTTCTGGAAGCG

TTTCTCAACCGTCTGTGTTCTTCCCAACTGAAGGGTGGAAAAGGATCACCTACCCGCTTCCTGAAAGCTTAACGGGGAA TCCTGTAAGATTTAGGTTCT

ACCAAAAGTACTCAGATGTGCAGTGGGCAATTGACAATTTCTACCTTGGCCCTGGATGTTTGGACAACTGTGGAGGCCACGGAGACTGCCTAAAGGAACA

GTGTATCTGTGACCCAGGCTACTCAGGGCCAAACTGCTACTTAACTCACAGCCTGAAG ACTTTCCTGAAGGAGCGCTTTGACAGTGAGGAGATCAAGCC

TGACTTATGGATGTCCTTGGAAGGCGGAAGCACTTGTACAGAGTGCGGGGTCCTCGCCGAGAACACTGCACTCTATTTTGGGGGATCCACTGTGAGACAA

GCTATTACTCAAGACTTAGATCTCAGAGGTGCAAA ATTCCTGCAGTACTGGGGACGTATCGGCAGTGAGAACAACATGACATCTTGCCATCGGCCTGTC

TGCCGGAAGGAAGGCGTGCTGCTGGACTTCTCTACGGATGGAG GAATCACTTGGACCTTGCTTCACGAGATGGATTTCCAGAAATACATTTCTGTGAGG

CACGACTACATCCTCCTGCCTGAGGGGGCCCTCACCAACACAACTCGACTTCGCTGGTGGCAGCCTTTTGTCATCAGCAATGGGCTCGTGGTTTCCGGGG

TGGAGCGTGCGCAGTGGGCACTGGACAACATTCTGATTGGTGGAGCAGAAATCAATCCAAGCCAACTGGTGGACACTTTCGATGACG AAGGCTCCTCCC

ATGAAGAAAACTGGAGTTTTTACCCTAATGCAGTAAGGACAGCAGGATTCTGTGGCAACCCATCCTTCCACCTCTACTGGCCAAATAAAAAGAAGGACAA

GACCCACAATGCACTCTCCTCCCGAGAGCTCATTATACAGCCAGGATACATGATGCAATTTAAA ATTGTGGTGGGTTGTGAAGCCACTTCATGTGGTGA

CCTTCATTCCGTGATGCTGGAGTACACCAAGGATGCAAG GTCCGATTCCTGGCAGCTCGTGCAGACCCAGTGCCTACCTTCCTCTTCCAATAGCATTGG

CTGCTCCCCGTTCCAGTTCCATGAAGCCACCATTTATAATGCTGTCAACAGCTCAAGCTGGAAGAGGATCACCATCCAGCTCCCAGACCACGTCTCGTCA

AG TGCCACACAGTTCCGCTGGATCCAGAAGGGAGAAGAAACCGAGAAGCAAAGCTGGGCCATCGACCACGTGTACATCGGAGAGGCTTGTCCCAAGCTC

TGCAGCGGGCATGGCTACTGCACCACAGGGGCCGTCTGCATCTGCGATGAAAGCTTCCAAG GTGACGACTGCTCTGTCTTCAGTCACGAGCTTCCTAGT

TACATTAAAGATAATTTTGAATCAGCAAGAGTCACTGAAGCCAACTGGGAAACCATCCAGGGTGGAGTGATCGGAAGTGGCTGTGGGCAGCTGGCGCCCT

ATGCCCATGGAGATTCGCTCTACTTTAATGGTTGTCAGATAAGGCAAGCTGCCACCAAGCCACTGGACCTCACTCGAGCAAG CAAAATTATGTTTGTCT

TGCAAATTGGGAGCCCAGCCCAGACAGACAGTTGCAACAGCGACCTCAGCGGCCCCCACACCGTGGACAAAGCAGTACTGCTGCAGTACAGTGTCAACAA

TGGCATCACCTGGCACGTCATCGCTCAGCACCAGCCGAAGGACTTCACACAAGCTCAGCGGGTGTCTTACAACGTCCCCCT GGAAGCTCGGATGAAAGG

AGTTCTACTGCGCTGGTGGCAGCCACGCCACAATGGAACAGGTCATGATCAATGGGCTTTGGACCATGTGGAGGTCGTCCTGTGA AGCACTCGCAAACA

AAATTACATGATGAATTTTTCACGGCAACATGGGCTCAGGCACTTCTACAACAGAAGACGAAGGTCGCTTAGGCGATACCCATGAAGAATCCAAGTTTAT

TTCCCTTTCCAGCGTACAATGTGTCCCTTCCTGGTTTTTTGAAACACCTCTCACTGCATCTGATATCAGGAAACAAAGATGAAGGACTTGGCGAACAGAA

AGCCCTTCGAGATCTTGTGTACCCCACCTTCCCACACTGTGAGCTAATGATGTGTGGTTTCTCTGCACATAAGTAAATGTCTTCACGTCAGTGCGTCCGT

GGAAATTGTGATCTGTTGTAATATCAGTTACAGTGGCAGTATTGAGAATAAGAAATAGTTTAACAGGAAAAAACGTTTAAGCACAAACATTTTTAAGATC

TTATGTTTTAAGTGGCATTTTAGCACAGTATTTAACATTGTTGGTCACCGAGCTATTTAAGTAGACTGTATTTCAGCTCTGTCTCTTGTTTATATGAATA

AGTTCTCGTCGTTTGTCCTTTATGTATTCTTCTCTACCGTATAACACACTGAAACTGTATCTACTTGCTGTGTTGCAATATTTTGCTGCTGGACTTTGAC

CTACTTGTATTATGCAGAAAGTTAATGCAGATACCTATTCAAGATGATAACTGTAAAGACACTGCTGTCTCCTTAATATGCTCCTTAACACGTATGTTGA

TGTAGCATCATTTTGTGGATAGGAAAAAAAATGTTTGACCTTCAGATATTTTCTACTTAAAAAATTGTGGATGAACGCCCTATCTCCCTCCCACAGTGGA

GTCCCCATTACCTTGTCTAAAACAATTTTTTAATGTGTTCTGTGGCCGTTTTACTGACAGTAACTGCCATTTCGTGTCTGTGGTAACAAAGTGACTTGTA

AAATGGTGGATGTTTCCCTCACTGTGTTCTCTTCGTGGGTTGTTTCCTTGTGGGTCATAGTCATACCTTCTGATGAGGTGGAGCCAACACCAGCAAAGTA

TGATGGCCCTGTAGCCTCTGACTAGTCCTGAAACAGAAGGCTGCACTCTAGGCTGAACCATGCTAAAAGCCCATGCTTAAATAAAAAATTATGTCCAAAA

TCTA
Translation
MERGCWAPRALVLAVLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAGNPTYYVPGQEYHV VTISTSTFFDGLLVTGLYTSTS

IQSSQSIGGSSAFGFG GIMSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFM - UNI34944 - MATATHRGQVIFKDALAQQLCEQ

GA - UNI34944 - APTEATAYSHLA - UNI34944 - AEIHSDSVILRDDFDSYQQLELNPNIW WVECSNCEMGEQCGTIMHGNAVTFCEPYGP

REL TTTCLNTTTASVLQFSIG GSGSCRFSYSDPSITVSYAKNNTADWIQLEKIR RAPSNVSTVIHILYLPEEAKGESVQFQWKQDSLRVGEVYEACW

ALDNILVINSAHREVVLEDNLDPVDTGNWLFFPGATVK HSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQWSEEFESQPTG GWDILGAVVGA

DCGTVESGLSLVFLKDGERKLCTPYMDTTGYGNLRFYFVMG GGICDPGVSHENDIILYAKIEGRKEHIALDTLTYSSYK VPSLVSVVINPELQTPATK

FCLRQKSHQGYNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNS SVSLEFSTNHGRSWSLLHTECLPEICAGPHLPHSTVYSSENYSG GWN

RITIPLPNAALTRDTRIRWRQTGPILGNMWAIDNV VYIGPSCLKFCSGRGQCTRHGCK KCDPGFSGPACEMASQTFPMFISESFGSARLSSYHNFYSI

RGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSR RFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYVNYHEPR RIIS

VELPDDARQFGIQFRWWQPYHSSQGEDVWAIDEIVMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTLC CFTGDSKLASSMRYVETQSMQIG

ASYMIQFSLVMGCGQKYTPHMDNQVKLEYSANHGLTWHLVQE ECLPSMPSCQEFTSASIYHASEFTQWRRVTVVLPQKTW WSGATRFRWSQSYYTAQD

EWALDNIYIGQQCPNMCSGHGSCDHGVCR RCDQGYQGTECHPEAALPSTIMSDFENPSSWESDWQEVIGGEVVKPEQGCGVVSSGSSLYFSK AGKRQL

VSWDLDTSWVDFVQFYIQIGGESAACNKPDSREEGILLQYSNNGGIQWHLLAEMYFSDFSKPR RFVYLELPAAAKTPCTRFRWWQPVFSGEDYDQWAVD

DIIILSEKQKQVIPVVNPTLPQ NFYEKPAFDYPMNQMSVWLMLANEGMAKNDSFCATTPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFK LNIGCTSQF

SSTAPVLLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSLASS SKTRFRWIQESSSQKNVPPFGLDGVYISEP

CPSYCSGHGDCISGVCFCDLGYTA AAQGTCVSNTPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGRSLYFNGLGKREARTVPLDTRNIR RLVQ

FYIQIGSKTSGITCIKPRARNEG GLVVQYSNDNGILWHLLRELDFMSFLEPQIISIDLPREAKTPATAFRWWQPQHG GKHSAQWALDDVLIGVNDSSQ

TGFQDKFDGSIDLQANWYRIQGGQVDIDCLSMDTALIFTENIG GKPRYAETWDFHVSASSFLQFEMNMGCSKPFSGAHGIQLQYSLNNGKDWQLVTEEC

VPPTIGCVHYTESSTYTSERFQNWRRVTVYLPLATN NSPRTRFRWIQTNYTVGADSWAIDNVILASGCPWMCSGRGICDSGRCV VCDRGFGGPFCVPV

VPLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTCLIFKG EGLRMLISRDLDCTNTMYVQFSLRFIAKG GTPERSHSILLQFSVSGGVTWHL

MDEFYFPQTTSILFINVPLPYGAQTNATRFRLWQPYNNG GKKEEIWIIDDFIIDGNNLNNPVLLLDTFDFGPREDNWFFYPGGNIGLYCPYSSKGAP P

EEDSAMVFVSNEVGEHSITTRDLSVNENTIIQFE INVGCSTDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRR

EVVHFGKLHLCG GSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCYGHGSCINGTKCICDPGYSGPTCKISTKNPDFLKDDFEG GQLESDRFLLM

SGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDLDLSHAR RFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEMPLK

ARSGSTRLRWWQPSENGHFYSPWVIDQ ILIGGNISGNTVLEDDFSTLDSRKWLLHPGGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDF

AASCSVTDSCYA AIELEYSVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPSYTR RSQATRFRWHQPAPFDKQQTWAIDNVYIG

DGCLDMCSGHGRCVQGSCV VCDEQWGGLYCDEPETSLPTQLKDNFNRAPSNQNWLTVSGGKLSTVCGAVASGLALHFSG GCSRLLVTVDLNLTNAEFI

QFYFMYGCLITPSNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPG GFVNILLPPDAKEIATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDT

FSSAPVPQHERSPADAGPVGRIAFEMFLEDKTSV VNENWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTENWIMQFK ISVGCKVPEKIA

QNQIHVQFSTDFGVSWSYLVPQCLPADPKCSGSVSQPSVFFPTEGWKRITYPLPESLTGN NPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCGGHGDCLK

EQCICDPGYSGPNCYLTHSLK TFLKERFDSEEIKPDLWMSLEGGSTCTECGVLAENTALYFGGSTVRQAITQDLDLRGAK KFLQYWGRIGSENNMTSC

HRPVCRKEGVLLDFSTDGG GITWTLLHEMDFQKYISVRHDYILLPEGALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEINPSQLVDTFD

DE EGSSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMMQFK IVVGCEATSCGDLHSVMLEYTKDAR RSDSWQLVQTQ

CLPSSSNSIGCSPFQFHEATIYNAVNSSSWKRITIQLPDHVSSS SATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHGYCTTGAVCICDESFQG 

GDDCSVFSHELPSYIKDNFESARVTEANWETIQGGVIGSGCGQLAPYAHGDSLYFNGCQIRQAATKPLDLTRAS SKIMFVLQIGSPAQTDSCNSDLSGP

HTVDKAVLLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPL LEARMKGVLLRWWQPRHNGTGHDQWALDHVEVVL 
Transcript ENSMUST00000062372
Sequence
CCCAAGCCCGGCCGAGGGGCGTCGCGTGCACACCGGCGGCGGCGGCGCTCGGAGGCGGACGACGCGCTCTCGGCGCCCGCGGCCCCGGTTCCCCCCGCGC

TCTCGCTCCGGCGGCCCAAAGTAACTTCGGGAGCCTCGGTCTCCCGCTAACTTCCCCCCGCGGGCTCGGTTGCCCGGACCCGCTCGGCTCGAGCCCGCCG

CCGGCTCGCCTTCCCCGCACGCGGCTCCTCCGTGCCGGTGCCTCCGAAAGTGGATGAGAGAGCGCGCGGGGCGCGCGGCGGCACGGAGCGCGGCGGCATG

GAGCGCGGCTGCTGGGCGCCGCGGGCTCTCGTCCTGGCCGTGCTGCTGCTGCTGGCGACGCTGAGGGCGCGCGCGGCCACCGGCTACTACCCGCGCTTCT

CGCCTTTCTTTTTCCTGTGCACCCACCACGGGGAGCTGGAAGGGGATGGGGAGCAGGGCGAGGTGCTCATTTCCCTGCACATTGCGGGCAACCCCACCTA

CTACGTACCGGGACAGGAATACCATG TTACAATTTCAACAAGCACCTTCTTTGATGGCTTGCTGGTGACGGGACTCTATACCTCGACAAGCATCCAGTC

TTCTCAGAGCATTGGAGGCTCCAGCGCCTTTGGATTCG GGATCATGTCCGACCACCAGTTTGGTAACCAGTTTATGTGCAGTGTGGTGGCCTCTCATGT

GAGTCACCTGCCTACAACCAACCTCAGCTTTGTCTGGATTGCCCCACCAGCTGGCACAGGCTGTGTGAATTTCAT - UNI34944 - GGCTACTGCAA

CACATAGGGGCCAGGTGATTTTCAAAGACGCACTGGCCCAGCAGCTGTGTGAACAAGGAG - UNI34944 - CTCCCACAGAGGCCACTGCTTACTCG

CACCTTG - UNI34944 - CTGAAATACACAGTGACAGTGTGATCCTACGAGATGACTTTGACTCCTACCAGCAACTGGAATTGAACCCCAACATATG

 GGTTGAATGCAGCAACTGTGAGATGGGAGAGCAGTGTGGCACCATCATGCATGGCAATGCTGTCACCTTCTGTGAGCCGTACGGCCCTCGAGAGCTG A

CCACCACATGCCTGAACACAACAACAGCATCTGTCCTCCAGTTTTCCATTG GGTCAGGATCATGTCGATTTAGTTACTCTGACCCCAGCATCACTGTGT

CATACGCCAAGAACAATACCGCTGATTGGATTCAGCTGGAGAAAATTAG AGCCCCTTCCAATGTGAGCACAGTCATCCACATCCTGTACCTCCCCGAGG

AAGCCAAAGGGGAGAGCGTGCAGTTCCAGTGGAAACAGGACAGCCTGCGAGTGGGTGAGGTGTATGAGGCCTGCTGGGCCCTGGATAACATCCTGGTCAT

CAATTCAGCCCACAGAGAAGTCGTTCTGGAGGACAACCTCGACCCGGTCGACACGGGCAACTGGCTCTTCTTCCCTGGAGCAACGGTCAAG CATAGCTG

TCAGTCAGATGGGAACTCCATTTATTTCCATGGAAATGAAGGCAGCGAGTTCAATTTTGCCACCACCCGGGATGTAGATCTTTCTACAGAGGATATTCAA

GAGCAGTGGTCAGAAGAATTTGAGAGCCAGCCCACAGG ATGGGATATCTTGGGAGCAGTAGTTGGTGCAGACTGTGGAACCGTAGAATCAGGACTATCA

CTGGTGTTCCTCAAAGATGGAGAGAGGAAGCTTTGCACCCCCTACATGGATACAACTGGTTATGGCAACCTGAGGTTCTACTTCGTTATGG GAGGAATC

TGTGACCCTGGAGTCTCTCATGAAAACGATATCATCTTATATGCAAAGATTGAAGGAAGAAAAGAACACATTGCACTGGACACTCTTACCTATTCTTCCT

ATAAG GTTCCGTCTTTGGTTTCTGTGGTCATCAACCCTGAACTTCAGACACCTGCCACCAAATTTTGTCTCAGGCAAAAGAGCCACCAAGGGTATAATC

GGAATGTCTGGGCTGTGGACTTCTTCCATGTGCTGCCCGTTCTCCCTTCAACAATGTCTCACATGATCCAGTTTTCTATTAATTTGGGATGCGGCACACA

CCAGCCTGGGAACAG CGTCAGCTTGGAGTTTTCTACTAACCATGGACGGTCCTGGTCCCTACTCCACACTGAGTGCTTGCCGGAGATCTGTGCAGGCCC

CCACCTCCCCCACAGCACTGTCTACTCCTCAGAAAACTACAGCGG GTGGAACCGAATCACGATTCCTCTCCCTAATGCAGCACTCACCCGAGACACCAG

GATTCGCTGGAGACAAACAGGCCCAATCCTGGGAAATATGTGGGCAATTGATAATG TTTATATAGGTCCTTCGTGTCTCAAATTCTGTTCTGGCAGAGG

ACAATGCACTCGGCATGGCTGCAA GTGTGACCCAGGATTTTCTGGCCCAGCTTGTGAGATGGCATCTCAGACATTCCCAATGTTTATTTCGGAAAGCTT

TGGCAGTGCCAGACTTTCCTCTTACCATAACTTTTACTCTATCCGTGGTGCTGAAGTCAGCTTTGGTTGTGGTGTCTTAGCCAGTGGTAAGGCTCTGGTT

TTCAACAAAGATGGGAGGCGGCAGCTAATCACGTCCTTTCTGGACAGCTCGCAGTCCAG GTTTCTTCAGTTTACACTGAGGCTGGGGAGCAAGTCTGTG

CTGAGCACGTGCAGAGCCCCTGACCAGCCGGGGGAGGGAGTCCTGCTGCACTATTCATATGACAACGGGATAACATGGAAACTCCTGGAGCACTATTCCT

ACGTCAACTACCACGAGCCCAG AATAATCTCTGTAGAGCTACCGGATGATGCAAGACAGTTTGGAATCCAGTTCAGATGGTGGCAGCCTTACCATTCTT

CCCAAGGAGAAGACGTGTGGGCCATTGATGAGATTGTCATGACCTCAGTCCTGTTCAACAGCATCAGTCTCGACTTTACCAATCTTGTGGAAGTCACTCA

ATCCCTGGGATTCTACCTTGGCAATGTTCAACCATACTGTGGCCATGACTGGACGCTTTG TTTTACGGGAGATTCTAAACTTGCCTCAAGCATGCGCTA

TGTGGAAACACAGTCCATGCAGATCGGAGCATCCTATATGATTCAGTTCAGCCTAGTGATGGGATGTGGCCAGAAATACACTCCTCACATGGACAACCAG

GTGAAGCTGGAGTACTCAGCCAACCACGGCCTTACATGGCACCTTGTACAAGAA GAATGCCTTCCCAGTATGCCAAGCTGCCAGGAATTTACATCTGCC

AGCATTTACCATGCCAGCGAGTTCACACAGTGGAGAAGAGTCACTGTTGTTCTTCCCCAGAAAACATG GTCCGGTGCCACCCGCTTCCGTTGGAGTCAG

AGCTATTACACAGCCCAGGATGAGTGGGCTTTAGACAACATTTACATTGGGCAGCAGTGCCCCAACATGTGCAGTGGGCATGGCTCATGTGACCATGGCG

TGTGCAG GTGTGACCAGGGATACCAGGGCACTGAATGCCACCCAGAAGCTGCACTTCCTTCCACGATTATGTCAGATTTTGAGAACCCGAGCAGTTGGG

AATCAGACTGGCAGGAAGTTATTGGGGGAGAAGTTGTAAAGCCTGAGCAAGGCTGTGGAGTCGTGTCTTCTGGATCTTCTCTGTACTTCAGCAAG GCTG

GGAAGAGGCAGCTGGTGAGCTGGGACCTGGACACATCCTGGGTGGACTTTGTCCAGTTCTACATCCAGATAGGAGGAGAGAGTGCTGCATGCAACAAGCC

TGACAGCAGAGAGGAGGGCATTCTGCTCCAGTATAGCAACAACGGGGGCATCCAGTGGCACCTGCTGGCAGAGATGTACTTCTCAGACTTCAGCAAACCC

AG ATTTGTCTACCTGGAGCTCCCAGCTGCTGCGAAGACCCCTTGTACCAGGTTCCGCTGGTGGCAGCCTGTGTTCTCGGGGGAGGACTATGACCAGTGG

GCCGTTGATGATATCATCATTCTGTCAGAGAAGCAGAAGCAGGTTATTCCAGTTGTCAACCCAACTTTGCCCCAG AACTTCTATGAGAAGCCAGCTTTC

GATTACCCTATGAACCAAATGAGTGTGTGGCTAATGTTGGCCAATGAAGGCATGGCTAAAAACGACAGCTTCTGTGCGACCACGCCGTCAGCCATGGTGT

TTGGAAAGTCAGATGGAGACCGGTTTGCAGTAACTCGAGATCTGACCCTGAAACCTGGATATGTGCTGCAGTTCAAG CTAAACATAGGCTGCACCAGCC

AGTTCAGCAGCACTGCCCCGGTTCTCCTGCAGTATTCACATGATGCCGGCATGTCGTGGTTTCTGGTGAAGGAAGGATGCTTCCCAGCGTCAGCAGGCAA

AGGATGTGAAGGGAACTCCAGGGAATTGAGTGAGCCTACTGTCTATTATACTGGGGACTTCGAAGAATGGACTAGAATCACCATTGCCATTCCAAGGTCC

CTTGCATCCAG CAAGACCAGATTCCGATGGATCCAAGAGAGCAGCTCTCAGAAGAATGTGCCCCCGTTTGGCTTAGATGGGGTGTACATATCTGAGCCT

TGTCCCAGTTACTGCAGTGGCCATGGAGACTGCATCTCGGGGGTGTGTTTTTGTGACCTGGGGTACACAG CTGCACAAGGAACCTGTGTGTCAAACACC

CCTAACCACAGTGAGATGTTCGACAGGTTTGAGGGGAAGCTAAGCCCACTGTGGTACAAAATCACCGGGGGTCAGGTTGGCACGGGCTGTGGCACCCTCA

ATGACGGCAGGTCCCTCTACTTTAATGGCCTTGGGAAAAGGGAAGCCAGGACAGTCCCACTGGACACCAGGAATATCAG ACTTGTTCAGTTTTATATAC

AAATTGGAAGTAAAACATCAGGGATTACGTGCATCAAACCACGGGCTAGAAATGAGG GGCTTGTTGTTCAGTATTCCAATGATAATGGGATACTTTGGC

ATTTGCTGAGAGAGTTGGATTTCATGTCATTCCTGGAGCCACAGATCATTTCCATTGACCTGCCCCGGGAAGCAAAGACACCTGCCACAGCTTTCCGGTG

GTGGCAGCCGCAGCATG GGAAGCATTCGGCCCAGTGGGCTTTGGATGATGTCCTTATAGGAGTGAATGACAGCTCTCAAACTGGATTTCAAGATAAATT

TGATGGCTCCATAGACTTGCAAGCCAACTGGTATCGAATCCAGGGAGGCCAAGTTGATATCGACTGCCTCTCTATGGACACTGCCCTTATATTCACTGAA

AACATAG GAAAACCTCGCTATGCTGAGACCTGGGACTTCCATGTGTCAGCGTCAAGCTTCTTACAGTTTGAAATGAACATGGGCTGCAGCAAGCCTTTC

AGTGGTGCCCACGGCATACAGCTCCAGTACTCTCTGAACAACGGCAAGGACTGGCAGCTTGTCACCGAAGAGTGTGTCCCTCCAACCATTGGCTGCGTGC

ACTACACAGAGAGTTCAACTTACACATCAGAAAGATTCCAGAACTGGAGGCGGGTCACGGTCTACCTGCCACTCGCCACCAA TTCTCCCAGGACTCGGT

TCAGATGGATTCAGACCAACTATACTGTTGGAGCAGATTCCTGGGCTATTGATAATGTCATCCTGGCCTCGGGCTGTCCTTGGATGTGCTCAGGACGAGG

GATCTGTGATTCGGGGCGCTGTGT GTGTGACCGGGGCTTCGGTGGACCCTTCTGTGTTCCTGTTGTTCCTCTTCCCTCCATTCTAAAAGATGATTTCAA

TGGGAACTTACATCCTGACCTTTGGCCTGAAGTGTACGGGGCAGAGAGGGGCAATCTGAATGGCGAAACCATCAAATCCGGAACATGTCTGATCTTTAAA

GGG GAGGGACTAAGAATGCTTATTTCCAGAGATCTAGATTGCACCAATACTATGTATGTCCAGTTCTCTCTCCGATTTATAGCGAAAG GTACCCCAGA

GAGGTCTCACTCCATCCTTCTACAGTTCTCTGTCAGTGGAGGAGTCACCTGGCACCTGATGGATGAATTCTACTTCCCTCAAACGACCAGCATACTTTTC

ATCAATGTTCCCTTACCATACGGTGCCCAAACCAACGCTACAAGATTCAGACTCTGGCAACCGTACAATAATG GTAAGAAAGAAGAAATCTGGATCATT

GATGACTTTATTATTGATGGAAACAATTTGAACAACCCCGTGCTGCTGCTGGACACGTTCGACTTTGGGCCCAGGGAAGACAATTGGTTTTTCTATCCGG

GTGGTAATATCGGACTTTACTGCCCGTATTCTTCAAAGGGAGCTCC TGAGGAGGATTCGGCCATGGTGTTTGTTTCAAACGAAGTTGGAGAACACTCCA

TTACCACACGAGACCTAAGTGTGAACGAGAACACCATCATTCAATTTGAG ATCAATGTTGGCTGCTCCACTGATAGTTCTTCTGCTGATCCGGTCAGAC

TGGAATTCTCAAGGGACTTTGGAGCCACCTGGCACCTGCTGCTGCCTCTCTGCTACCACAGCAGCAGCCTCGTCAGCTCCTTATGCTCCACTGAGCATCA

CCCGAGCAGCACCTACTACGCGGGGACCACCCAGGGCTGGCGGCGGGAGGTCGTGCACTTCGGAAAGCTGCACCTTTGTGG ATCTGTGCGTTTCCGTTG

GTACCAGGGATTTTATCCTGCTGGCTCTCAGCCGGTCACATGGGCCATTGACAATGTCTACATTGGTCCCCAGTGTGAAGAGATGTGCTATGGGCACGGG

AGCTGCATCAATGGAACCAAGTGTATATGTGACCCGGGCTACTCTGGGCCAACCTGTAAAATAAGCACCAAAAATCCTGATTTTCTCAAAGACGACTTTG

AAG GTCAACTGGAATCCGATCGATTCTTACTGATGAGCGGTGGGAAGCCGTCTCGTAAGTGTGGCATCCTTTCCAGTGGGAACAACCTCTTCTTCAATG

AGGACGGCTTGCGCATGCTAGTAACACGGGACCTGGATTTATCACATGCAAG GTTTGTGCAGTTCTTCATGAGACTGGGATGTGGTAAAGGTGTTCCAG

ACCCCAGGAGCCAGCCCGTGCTTCTGCAGTACTCCCTCAATGGCGGCCTCTCCTGGAGTCTTCTTCAAGAGTTCCTCTTCAGCAACTCCAGCAATGTGGG

CAGGTACATTGCCCTGGAAATGCCCCTGAAAGCCCGTTCTGGTTCGACACGCCTCCGCTGGTGGCAGCCATCTGAAAATGGGCACTTCTATAGCCCCTGG

GTGATCGACCAG ATTCTTATTGGAGGAAATATCTCTGGTAATACAGTCTTAGAAGATGATTTCTCAACTCTGGACAGCAGAAAGTGGCTGCTTCACCCA

GGAGGCACCAAGATGCCTGTGTGTGGCTCCACAGGCGATGCCCTGGTCTTTATTGAAAAGGCCAGCACCCGTTACGTGGTCACGACAGACATCGCTGTGA

ATGAGGACTCATTCCTACAGATAGACTTTGCTGCCTCCTGCTCAGTCACAGACTCCTGCTATG CTATTGAACTGGAGTACTCGGTGGATCTCGGTCTGT

CGTGGCACCCGCTGGTGAGGGACTGCCTGCCTACCAATGTTGAGTGTAGTCGTTACCACCTGCAGCGGATCCTGGTGTCAGATACTTTCAACAAGTGGAC

CAGAATCACTCTGCCCCTGCCTTCCTACACCAG GTCTCAAGCCACTCGTTTCCGCTGGCATCAGCCAGCGCCTTTTGACAAGCAGCAGACCTGGGCAAT

AGATAATGTCTATATTGGGGATGGTTGCCTAGACATGTGCAGTGGCCACGGGAGATGCGTCCAGGGAAGCTGTGT CTGTGATGAACAGTGGGGAGGCCT

GTACTGTGATGAGCCTGAGACCTCCCTTCCCACCCAGCTCAAAGACAACTTCAACCGAGCCCCCTCCAACCAGAACTGGCTGACTGTGAGCGGTGGGAAG

CTGAGTACAGTGTGTGGGGCTGTGGCTTCCGGCCTGGCTCTCCATTTCAGTGGG GGCTGCAGCCGATTGTTAGTCACTGTGGATCTGAACCTCACCAAT

GCTGAGTTTATCCAGTTTTACTTTATGTATGGATGCCTCATTACGCCGAGCAACCGTAACCAGGGAGTCCTGCTGGAGTACTCTGTCAATGGAGGCATCA

CCTGGAACTTGCTGATGGAGATTTTCTATGACCAGTACAGCAAACCTGG ATTTGTGAATATCCTTCTCCCTCCTGATGCTAAAGAGATTGCCACTCGCT

TCCGATGGTGGCAGCCACGACATGATGGCCTTGACCAGAATGACTGGGCCATTGACAATGTCCTCATCTCGGGCTCTGCGGACCAGAGGACAGTCATGCT

GGACACCTTTAGCAGCGCCCCAGTACCACAGCATGAGCGCTCCCCCGCAGACGCTGGCCCTGTTGGAAGAATTGCTTTTGAAATGTTCTTAGAAGACAAA

ACTTCAG TGAATGAGAATTGGCTCTTCCATGATGACTGTACAGTGGAAAGATTCTGTGACTCGCCAGATGGTGTCATGCTCTGTGGCAGCCATGATGGA

CGAGAGGTGTATGCAGTGACTCATGACCTGACGCCCACTGAGAACTGGATCATGCAGTTCAAG ATCTCTGTTGGATGCAAAGTGCCTGAAAAAATTGCC

CAGAATCAAATTCACGTGCAGTTTTCTACTGACTTTGGCGTGAGCTGGAGTTATTTAGTCCCTCAGTGCTTACCCGCCGACCCAAAGTGTTCTGGAAGCG

TTTCTCAACCGTCTGTGTTCTTCCCAACTGAAGGGTGGAAAAGGATCACCTACCCGCTTCCTGAAAGCTTAACGGGGAA TCCTGTAAGATTTAGGTTCT

ACCAAAAGTACTCAGATGTGCAGTGGGCAATTGACAATTTCTACCTTGGCCCTGGATGTTTGGACAACTGTGGAGGCCACGGAGACTGCCTAAAGGAACA

GTGTATCTGTGACCCAGGCTACTCAGGGCCAAACTGCTACTTAACTCACAGCCTGAAG ACTTTCCTGAAGGAGCGCTTTGACAGTGAGGAGATCAAGCC

TGACTTATGGATGTCCTTGGAAGGCGGAAGCACTTGTACAGAGTGCGGGGTCCTCGCCGAGAACACTGCACTCTATTTTGGGGGATCCACTGTGAGACAA

GCTATTACTCAAGACTTAGATCTCAGAGGTGCAAA ATTCCTGCAGTACTGGGGACGTATCGGCAGTGAGAACAACATGACATCTTGCCATCGGCCTGTC

TGCCGGAAGGAAGGCGTGCTGCTGGACTTCTCTACGGATGGAG GAATCACTTGGACCTTGCTTCACGAGATGGATTTCCAGAAATACATTTCTGTGAGG

CACGACTACATCCTCCTGCCTGAGGGGGCCCTCACCAACACAACTCGACTTCGCTGGTGGCAGCCTTTTGTCATCAGCAATGGGCTCGTGGTTTCCGGGG

TGGAGCGTGCGCAGTGGGCACTGGACAACATTCTGATTGGTGGAGCAGAAATCAATCCAAGCCAACTGGTGGACACTTTCGATGACG AAGGCTCCTCCC

ATGAAGAAAACTGGAGTTTTTACCCTAATGCAGTAAGGACAGCAGGATTCTGTGGCAACCCATCCTTCCACCTCTACTGGCCAAATAAAAAGAAGGACAA

GACCCACAATGCACTCTCCTCCCGAGAGCTCATTATACAGCCAGGATACATGATGCAATTTAAA ATTGTGGTGGGTTGTGAAGCCACTTCATGTGGTGA

CCTTCATTCCGTGATGCTGGAGTACACCAAGGATGCAAG GTCCGATTCCTGGCAGCTCGTGCAGACCCAGTGCCTACCTTCCTCTTCCAATAGCATTGG

CTGCTCCCCGTTCCAGTTCCATGAAGCCACCATTTATAATGCTGTCAACAGCTCAAGCTGGAAGAGGATCACCATCCAGCTCCCAGACCACGTCTCGTCA

AG TGCCACACAGTTCCGCTGGATCCAGAAGGGAGAAGAAACCGAGAAGCAAAGCTGGGCCATCGACCACGTGTACATCGGAGAGGCTTGTCCCAAGCTC

TGCAGCGGGCATGGCTACTGCACCACAGGGGCCGTCTGCATCTGCGATGAAAGCTTCCAAG GTGACGACTGCTCTGTCTTCAGTCACGAGCTTCCTAGT

TACATTAAAGATAATTTTGAATCAGCAAGAGTCACTGAAGCCAACTGGGAAACCATCCAGGGTGGAGTGATCGGAAGTGGCTGTGGGCAGCTGGCGCCCT

ATGCCCATGGAGATTCGCTCTACTTTAATGGTTGTCAGATAAGGCAAGCTGCCACCAAGCCACTGGACCTCACTCGAGCAAG CAAAATTATGTTTGTCT

TGCAAATTGGGAGCCCAGCCCAGACAGACAGTTGCAACAGCGACCTCAGCGGCCCCCACACCGTGGACAAAGCAGTACTGCTGCAGTACAGTGTCAACAA

TGGCATCACCTGGCACGTCATCGCTCAGCACCAGCCGAAGGACTTCACACAAGCTCAGCGGGTGTCTTACAACGTCCCCCT GGAAGCTCGGATGAAAGG

AGTTCTACTGCGCTGGTGGCAGCCACGCCACAATGGAACAGGTCATGATCAATGGGCTTTGGACCATGTGGAGGTCGTCCT AGTAAG CACTCGCAAAC

AAAATTACATGATGAATTTTTCACGGCAACATGGGCTCAGGCACTTCTACAACAGAAGACGAAGGTCGCTTAGGCGATACCCATGA
Translation
MERGCWAPRALVLAVLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAGNPTYYVPGQEYHV VTISTSTFFDGLLVTGLYTSTS

IQSSQSIGGSSAFGFG GIMSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFM - UNI34944 - MATATHRGQVIFKDALAQQLCEQ

GA - UNI34944 - APTEATAYSHLA - UNI34944 - AEIHSDSVILRDDFDSYQQLELNPNIW WVECSNCEMGEQCGTIMHGNAVTFCEPYGP

REL TTTCLNTTTASVLQFSIG GSGSCRFSYSDPSITVSYAKNNTADWIQLEKIR RAPSNVSTVIHILYLPEEAKGESVQFQWKQDSLRVGEVYEACW

ALDNILVINSAHREVVLEDNLDPVDTGNWLFFPGATVK HSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQWSEEFESQPTG GWDILGAVVGA

DCGTVESGLSLVFLKDGERKLCTPYMDTTGYGNLRFYFVMG GGICDPGVSHENDIILYAKIEGRKEHIALDTLTYSSYK VPSLVSVVINPELQTPATK

FCLRQKSHQGYNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNS SVSLEFSTNHGRSWSLLHTECLPEICAGPHLPHSTVYSSENYSG GWN

RITIPLPNAALTRDTRIRWRQTGPILGNMWAIDNV VYIGPSCLKFCSGRGQCTRHGCK KCDPGFSGPACEMASQTFPMFISESFGSARLSSYHNFYSI

RGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSR RFLQFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYVNYHEPR RIIS

VELPDDARQFGIQFRWWQPYHSSQGEDVWAIDEIVMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTLC CFTGDSKLASSMRYVETQSMQIG

ASYMIQFSLVMGCGQKYTPHMDNQVKLEYSANHGLTWHLVQE ECLPSMPSCQEFTSASIYHASEFTQWRRVTVVLPQKTW WSGATRFRWSQSYYTAQD

EWALDNIYIGQQCPNMCSGHGSCDHGVCR RCDQGYQGTECHPEAALPSTIMSDFENPSSWESDWQEVIGGEVVKPEQGCGVVSSGSSLYFSK AGKRQL

VSWDLDTSWVDFVQFYIQIGGESAACNKPDSREEGILLQYSNNGGIQWHLLAEMYFSDFSKPR RFVYLELPAAAKTPCTRFRWWQPVFSGEDYDQWAVD

DIIILSEKQKQVIPVVNPTLPQ NFYEKPAFDYPMNQMSVWLMLANEGMAKNDSFCATTPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFK LNIGCTSQF

SSTAPVLLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSLASS SKTRFRWIQESSSQKNVPPFGLDGVYISEP

CPSYCSGHGDCISGVCFCDLGYTA AAQGTCVSNTPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGRSLYFNGLGKREARTVPLDTRNIR RLVQ

FYIQIGSKTSGITCIKPRARNEG GLVVQYSNDNGILWHLLRELDFMSFLEPQIISIDLPREAKTPATAFRWWQPQHG GKHSAQWALDDVLIGVNDSSQ

TGFQDKFDGSIDLQANWYRIQGGQVDIDCLSMDTALIFTENIG GKPRYAETWDFHVSASSFLQFEMNMGCSKPFSGAHGIQLQYSLNNGKDWQLVTEEC

VPPTIGCVHYTESSTYTSERFQNWRRVTVYLPLATN NSPRTRFRWIQTNYTVGADSWAIDNVILASGCPWMCSGRGICDSGRCV VCDRGFGGPFCVPV

VPLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTCLIFKG EGLRMLISRDLDCTNTMYVQFSLRFIAKG GTPERSHSILLQFSVSGGVTWHL

MDEFYFPQTTSILFINVPLPYGAQTNATRFRLWQPYNNG GKKEEIWIIDDFIIDGNNLNNPVLLLDTFDFGPREDNWFFYPGGNIGLYCPYSSKGAP P

EEDSAMVFVSNEVGEHSITTRDLSVNENTIIQFE INVGCSTDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRR

EVVHFGKLHLCG GSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCYGHGSCINGTKCICDPGYSGPTCKISTKNPDFLKDDFEG GQLESDRFLLM

SGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDLDLSHAR RFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEMPLK

ARSGSTRLRWWQPSENGHFYSPWVIDQ ILIGGNISGNTVLEDDFSTLDSRKWLLHPGGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDF

AASCSVTDSCYA AIELEYSVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPSYTR RSQATRFRWHQPAPFDKQQTWAIDNVYIG

DGCLDMCSGHGRCVQGSCV VCDEQWGGLYCDEPETSLPTQLKDNFNRAPSNQNWLTVSGGKLSTVCGAVASGLALHFSG GCSRLLVTVDLNLTNAEFI

QFYFMYGCLITPSNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPG GFVNILLPPDAKEIATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDT

FSSAPVPQHERSPADAGPVGRIAFEMFLEDKTSV VNENWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTENWIMQFK ISVGCKVPEKIA

QNQIHVQFSTDFGVSWSYLVPQCLPADPKCSGSVSQPSVFFPTEGWKRITYPLPESLTGN NPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCGGHGDCLK

EQCICDPGYSGPNCYLTHSLK TFLKERFDSEEIKPDLWMSLEGGSTCTECGVLAENTALYFGGSTVRQAITQDLDLRGAK KFLQYWGRIGSENNMTSC

HRPVCRKEGVLLDFSTDGG GITWTLLHEMDFQKYISVRHDYILLPEGALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEINPSQLVDTFD

DE EGSSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMMQFK IVVGCEATSCGDLHSVMLEYTKDAR RSDSWQLVQTQ

CLPSSSNSIGCSPFQFHEATIYNAVNSSSWKRITIQLPDHVSSS SATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHGYCTTGAVCICDESFQG 

GDDCSVFSHELPSYIKDNFESARVTEANWETIQGGVIGSGCGQLAPYAHGDSLYFNGCQIRQAATKPLDLTRAS SKIMFVLQIGSPAQTDSCNSDLSGP

HTVDKAVLLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPL LEARMKGVLLRWWQPRHNGTGHDQWALDHVEVVL LVS STRKQNYMMNFSRQHGLR

HFYNRRRRSLRRYP

For any suggestions or comments, please send an email to unitrap@crg.es