Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042487 (Leo1)
Chromosomal location
Chr 9: 75289331 - 75314239 (+)
Description
Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:2685031]
RefSeq_dna
NM_001039522 
RefSeq_peptide
NP_001034611.1 
UniGene
Mm.400068 
MGI
MGI:2685031 
Uniprot/SWISSPROT
Q5XJE5 
Human Ortholog
ENSG00000166477 (LEO1)
Omim not available
UniTrap UNI5687
Vector Insertion
Chr 9: 75289443 - 75293041
Public Clones CSI622 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6047
Vector Insertion
Chr 9: 75293801 - 75294908
Public Clones YHD061 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5627
Vector Insertion
Chr 9: 75295014 - 75296108
Public Clones CSI809 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37805
Vector Insertion
Chr 9: 75296204 - 75297163
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2774
Vector Insertion
Chr 9: 75298380 - 75302430
Public Clones AK0005 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2579
Vector Insertion
Chr 9: 75308911 - 75314000
Public Clones XS0156 (sanger) (ggtc) CMHD-GT_434E7-3 (cmhd) CMHD-GT_513G11-3 (cmhd)
Private Clones OST461970 (lexicon) OST424347 (lexicon) OST422939 (lexicon) OST422836 (lexicon)
OST392686 (lexicon) OST371076 (lexicon) OST350750 (lexicon) OST350742 (lexicon)
OST324717 (lexicon) OST324715 (lexicon) OST324713 (lexicon) OST209448 (lexicon)
OST142995 (lexicon) OST59743 (lexicon) OST58568 (lexicon) OST58369 (lexicon)
OST58348 (lexicon) OST57707 (lexicon) OST57385 (lexicon) OST57384 (lexicon)
OST56891 (lexicon) OST56885 (lexicon) OST56583 (lexicon) OST55303 (lexicon)
OST54848 (lexicon) OST42926 (lexicon) OST42900 (lexicon) OST28503 (lexicon)
OST28319 (lexicon) OST27642 (lexicon) OST17449 (lexicon) OST17448 (lexicon)
OST16747 (lexicon) OST14246 (lexicon) OST14233 (lexicon) OST4027 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048937
Sequence
CTGGCCGTAAAGCAGGCTCGAGCCGAGCAAGCCAAGGCCGCGGACCAAGCTGCTATGGCGGACATGGAGGACCTCTTCGGGAGCGAAGCTGAGAGCGAGG

CCGAGCGCAAAG - UNI5687 - ATTCCGAGTCTGAGTCCGACTCGGACTCTGACCAGGACAACGGCGCTTCTGGCAGCAACGCCTCTGGCAGCGAAA

GTGATCAGGATGACAGAGGTGACTCCGGACAGCCCAGTAACAAGGAACTGTTCGGGGACGACAGTGAGGAGGAGGGGGCCTCTCATCACAGTGGCAGTGA

CAATCACTCTGAACGGTCAGACAATAGGTCGGAGGCTTCCGAGCGCTCTGACCACGAGGATAATGAGCCCTCTGACGAGGACCAGCACAGTGGCTCTGAA

GCCCACAACGATGACGACGATGAGGGCCACAGGTCGGACGAAGGGAGCCGTCACTCAGAGGCAGAAGGGTCTGAAAAAGCCCAGTCAGATGATGAGAAAT

GGGATGGAGAGGATAAAAGTGACCAGTCAGATGACGAGAAGCTGCAGAACTCTGACGACGAGGATCGGGAGCAAGGGTCCGATGAGGATAAGCTGCAGAA

CTCTGACGACGACGAGGAGAAAATGCAGAACACAGATGACGAGGACCGGGCCCAGATTTCTGATGATGACAGACAGCAGCTGTCTGAGGAGGAGAAGGGG

AATTCTGACGATGAGCATCCAGTAGCTTCTGATAATGACGAGGAGAAGCAGAATTCGGACGATGAGGACCAGCCGCAGGTGTCCGATGAGGAGAAAATGC

AGAACTCAGACGATGAAAGGCCACAAGTCTCAGATGAAGATGGAAGGCGTTCAGACGGTGAGGAGGAGCAAGACCAGAAGTCAG - UNI6047 - AAT

CTGCAAGAGGCAGTGACAGTGAAGATGAAGTTTTACGACTGAAGCGCAAGAACGCGATTCCATCGGATTCCGAAGCAGACAGCGACACCGAGGTGCCCAA

AG - UNI5627 - ATAATAATGGAACCATGGATCTGTTCGGAGGTGCAGATGACATATCTTCAGGGAGTGATGGAGAAGATAAGCCCCCAACTCCAGG

ACAGCCTGTG GATGAAAATGGCTTGCCCCAGGATCAGCAGGAGGAAGAGCCCATACCTGAGACCAGAATAGAAGTGGAGATCCCCAAAGTAAACACGGA

CTTGGGCAATGACTTATATTTTGTTAAACTGCCCAACTTCCTCAGTGTAGAGCCCAG GCCTTTTGATCCTCAGTATTATGAAGATGAATTTGAAGATGA

GGAGATGCTGGATGAAGAGGGGAGAACCAGGTTAAAATTGAAG - UNI2774 - GTAGAAAACACTATAAGATGGAGGATACGCAGAGATGAAGAAGG

AAATGAAATTAAAGAAAGCAATGCGCGGATCGTCAAGTGGTCAGATGGAAG CATGTCCCTGCATTTAGGGAATGAAGTGTTTGATGTGTACAAAGCCCC

ACTGCAGGGCGACCACAACCATCTTTTCATAAGACAAGGTACTGGGCTGCAGGGGCAGGCCGTCTTTAAAACGAAGCTCACCTTCAG GCCTCACTCTAC

AGACAGTGCCACACACAGGAAGATGACCCTGTCACTTGCAGATAGATGCTCAAAGACACAGAAGATTCGAATCTTACCAATGGCTGGCCGTGACCCTGAG

TGCCAGCGCACAGAGATGATTAAG AAAGAAGAAGAACGCCTGAGGGCCTCCATCAGGAGGGAGTCTCAGCAGCGCCGGATGCGAGAGAAACAGCACCAG

CGGGGGCTGAGCGCCAGCTACCTGGAGCCTGATCGCTACGACGAGGAGGAGGAAGGCGAGGAGTCCGTCAGCCTGGCTGCCATTAAAAACCGCTACAAAG

GGGGCATCCGCG AGGAACGAGCCAGAATCTACTCCTCGGACAGTGATGAGGGCTCCGAAGAAGACAAAGCTCAAAGGTTACTCAAAGCAAAGAAGCTCA

ACAGTGATGAG - UNI2579 - GAAGGTGAATCTTCTGGAAAGAGGAAAGCGGAAGACGATGACAAAGCGAATAAAAAGCATAAGAAGTATGTGATCA

GTGATGAAGAAGAAGAAGAAGATGACTGAGCTACAAACTGTGAATGCGTTTTATATATTTATTGTACAGCTTGTCTATAAATACAATGTAAACATGAGTT

ATTTTGATTGAGATTAATTGATCTGTTTGTGAAATTTTGATTGTAATAAAACATTTAAGGCAA
Translation
MADMEDLFGSEAESEAERKD - UNI5687 - DSESESDSDSDQDNGASGSNASGSESDQDDRGDSGQPSNKELFGDDSEEEGASHHSGSDNHSERSDN

RSEASERSDHEDNEPSDEDQHSGSEAHNDDDDEGHRSDEGSRHSEAEGSEKAQSDDEKWDGEDKSDQSDDEKLQNSDDEDREQGSDEDKLQNSDDDEEKM

QNTDDEDRAQISDDDRQQLSEEEKGNSDDEHPVASDNDEEKQNSDDEDQPQVSDEEKMQNSDDERPQVSDEDGRRSDGEEEQDQKSE - UNI6047 - 

ESARGSDSEDEVLRLKRKNAIPSDSEADSDTEVPKD - UNI5627 - DNNGTMDLFGGADDISSGSDGEDKPPTPGQPV DENGLPQDQQEEEPIPET

RIEVEIPKVNTDLGNDLYFVKLPNFLSVEPR RPFDPQYYEDEFEDEEMLDEEGRTRLKLK - UNI2774 - VENTIRWRIRRDEEGNEIKESNARIV

KWSDGS SMSLHLGNEVFDVYKAPLQGDHNHLFIRQGTGLQGQAVFKTKLTFR RPHSTDSATHRKMTLSLADRCSKTQKIRILPMAGRDPECQRTEMIK

 KEEERLRASIRRESQQRRMREKQHQRGLSASYLEPDRYDEEEEGEESVSLAAIKNRYKGGIRE EERARIYSSDSDEGSEEDKAQRLLKAKKLNSDE -

 UNI2579 - EGESSGKRKAEDDDKANKKHKKYVISDEEEEEDD

For any suggestions or comments, please send an email to unitrap@crg.es