Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042508 (Dmtf1)
Chromosomal location
Chr 5: 9118841 - 9161718 (-)
Description
cyclin D binding myb-like transcription factor 1 Gene [Source:MGI Symbol;Acc:MGI:1344415]
RefSeq_dna
NM_011806 
RefSeq_peptide
NP_001103797.1 NP_035936.3 
UniGene
Mm.395239 Mm.22480 
MGI
MGI:1344415 
Uniprot/SWISSPROT
Q8CE22 
Human Ortholog
ENSG00000135164 (DMTF1)
Omim not available
UniTrap UNI6927
Vector Insertion
Chr 5: 9151919 - 9161613
Public Clones (sanger) RRZ663 (baygenomics) XG656 (baygenomics) W226D06 (ggtc)
E059H02 (ggtc) P019B06 (ggtc) D005E12 (ggtc) P066G07 (ggtc) PST3305-NR (escells)
IST14262F2 (tigm) IST13068F1 (tigm) IST14700G4 (tigm) IST14558G12 (tigm)
Private Clones OST134891 (lexicon) OST84011 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9572
Vector Insertion
Chr 5: 9150493 - 9151797
Public Clones XG809 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11361
Vector Insertion
Chr 5: 9149023 - 9150375
Public Clones W073B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3195
Vector Insertion
Chr 5: 9140481 - 9148899
Public Clones (sanger) XR0248 (sanger) W014A12 (ggtc) IST10854E9 (tigm) IST11714A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23433
Vector Insertion
Chr 5: 9137241 - 9140385
Public Clones IST13306C5 (tigm) IST13251C2 (tigm) IST13034C3 (tigm) IST10702G11 (tigm)
IST13034B4 (tigm) IST13749A5 (tigm) IST13405D1 (tigm) IST13020G4 (tigm)
IST14023E12 (tigm) IST14255D5 (tigm)
Private Clones OST259937 (lexicon) OST179663 (lexicon) OST116823 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33448
Vector Insertion
Chr 5: 9132455 - 9136143
Public Clones (sanger) IST11629B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38503
Vector Insertion
Chr 5: 9131275 - 9132614
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 45% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000040604
Sequence
TCACCCCAGCTGCAGCCACTCTCTCCCGCGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCCTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAAC

AGGAA - UNI6927 - AGGATCACAGATGCACAAGCATGGAGGAGAAGCAGTTTGGTTAACGTGAGTGATGCTGCTGGCCGAAGCACAGAGGTGGGAT

TCTATGGGAAGGCCTGTAGCTAATCCACCTGTGGTCTAG - UNI9572 - ATTTGAGTATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAG

AAACTGTGAACTCTGTGACGTTTACTCAGGACACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATG - UNI11361 - ACCCTGATGAAGTAGAC

TCAGAAGACAGTACTGAACCTCCACATAAGAGGCTTTGTTTGTCCTCTGAGGATGATCAAAGCATTGATGACGCTACGCCATGCATATCAGTCGTGGCAC

TCCCAC - UNI3195 - TTTCAGAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAGAGGTGGCAGATGATGAACTTTCTGAGGGAACTG

TGACACAAATTCAG - UNI23433 - ATTTTACAGAATGATCAACTAGATGAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCG

TGGTTTACAACTAAAGAAGATAAGGATTCTCTCACTAACAAAG - UNI33448 - GACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGA

TATTTTAATGAACAACATCGAGCGCTATCTGAAG - UNI33448 - GCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGATGTCAAAAGACG

AAAGAAAAGATTTCTACAGGACTATAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTTTATAGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGT

GGGAAA - UNI33448 - ATACACTCCTGAAGAGATCGAGAAGCTCAAGGA ACAACTGTGGACCCCACACAATAAAGGCCACACTTTCAAACTTTGG

CTCTCAAAAGTATTGCTGCCCACAACTTGCCAGCCAGTCAGAAGGGAGAAGAAGAATGAAGAATAA
Translation
 - UNI6927 -  - UNI9572 - MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND - UNI11361 - DPDEVDSEDSTEPPHKRLCLSSE

DDQSIDDATPCISVVALPL - UNI3195 - LSENDQSFEVTMTATTEVADDELSEGTVTQIQ - UNI23433 - ILQNDQLDEISPLGTEEVSAVS

QAWFTTKEDKDSLTNKG - UNI33448 - GHKWKQGMWSKEEIDILMNNIERYLK - UNI33448 - ARGIKDATEIIFEMSKDERKDFYRTIAWG

LNRPLFAVYRRVLRMYDDRNHVGK - UNI33448 - KYTPEEIEKLKE EQLWTPHNKGHTFKLWLSKVLLPTTCQPVRREKKNEE
Transcript ENSMUST00000057436
Sequence
TCACCCCAGCTGCAGCCACTCTCTCCCGCGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCCTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAAC

AGGAA - UNI6927 - AGGATCACAGATGCACAAGCATGGAGGAGAAGCAGTTTGGTTAACGTGAGTGATGCTGCTGGCCGAAGCACAGAGGTGGGAT

TCTATGGGAAGGCCTGTAGCTAATCCACCTGTGGTCTAG - UNI9572 - ATTTGAGTATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAG

AAACTGTGAACTCTGTGACGTTTACTCAGGACACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATG - UNI3195 - - UNI11361 - TTTCA

GAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAGAGGTGGCAGATGATGAACTTTCTGAGGGAACTGTGACACAAATTCAG - UNI2343

3 - ATTTTACAGAATGATCAACTAGATGAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCGTGGTTTACAACTAAAGAAGATAAG

GATTCTCTCACTAACAAAG - UNI33448 - GACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGATATTTTAATGAACAACATCGAGCG

CTATCTGAAG - UNI33448 - GCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGATGTCAAAAGACGAAAGAAAAGATTTCTACAGGACTA

TAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTTTATAGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGTGGGAAA - UNI33448 - ATAC

ACTCCTGAAGAGATCGAGAAGCTCAAGGA GCTCCGGATAAAACACGGCAATGACTGGGCAACAATAGGGGCGGCCCTAGGAAGAAGTGCCTCTTCTGTC

AAAGACCGCTGCCGGCTGATGAAGGATACCTGCAACACAG GGAAATGGACAGAAGAAGAAGAAAAGAGACTTGCAGAGGTAGTTCATGAATTAACAAGC

ACGGAGCCAGGTGACATCGTCACACAGGGTGTGTCTTGGGCAGCTGTAGCTGAAAGAGTGGGTACCCGCTCAGAAAAGCAATGCCGTTCTAAATGGCTCA

ACTACCTGAACTGGAAGCAGAGTGGGGGTACTGAATGGACCAAGGAAGATGAAATCAATCTCATCCTAAG GATAGCTGAGCTTGATGTGGCCGATGAAA

ATGACATAAACTGGGATCTTTTAGCTGAAGGATGGAGCAGTGTCCGTTCACCACAGTGGCTTCGAAGTAAATGGTGGACCATCAAAAGGCAAATTGCAAA

CCATAAGGATGTTTCATTTCCTG TGTACAGCATGTTCAGATCAGAGTCGCCCGCTTGGAAGATAATACAGCCATCTCTCCAAGCCCCATGGCAGCGTTG

CAGATTCCAGTCCAGATCACCCACGTCT CTTCAACAGACTCCCCTGCTGCTTCTGTTGACTCAGAAACAATCACACTAAACAGTGGAACACTACAAACA

TTTGAGATTCTTCCA TCTTTCCATTTACAGCCCACTGGTACTCCAGGCACCTACCTTCTTCAAACAAGCTCAAGTCAAGGCCTTCCCCTAACACTGACC

ACAAATCCCACAGTAACCCTGGCAGCTGCTGCTCCTGCTTCTCCTGAACAGATCATTGTTCATGCTTTATCC CCAGAACATTTGTTGAACACAAGCGAT

AATGTCACGGTACAATGTCACACACCAAGAGTCATCATTCAGACGGTAGCTACAGAGGACATCACTTCTTCATTATCCCAAGAGGAACTGACAGTTGATA

GTGATCTTCATTCATCTGATTTCCCTGAGCCTCCAGATGCACTAGAAGCAGACACTTTCCCAGACGAAATTCCTCGGCCTAAGATGACTATACAACCATC

ATTTAATAATGCTCATGTATCTAAATTCAGCGACCAAAATAGCACAGAACTGATGAACAGTGTCATGGTCAGAACAGAGGAAGAAATTGCCGACACTGAC

CTTAAGCAGGAAGAACCGCCGTCTGACTTAGCCAGTGCTTATGTTACTGAG GATTTAGAGTCTCCCACCATAGTGCACCAAGTTCATCAGACAATTGAT

GATGAAACAATACTTATCGTTCCTTCACCTCATGGCTTTATCCAGGCATCTGATGTTATAGATACTGAATCTGTCTTGCCTTTGACAACACTAACAG AT

CCAATATTCCAGCATCATCAGGAAGCATCAAATATAATTGGATCATCTTTGGGCAGTCCTGTTTCTGAAGACTCAAAGGATGTTGAGGACTTAGTAAACT

GTCACTAGATTATTAGAAACAGGTACTTCAAGAAGCCACATTGTGACTACATTGTCTCCAAAGAAAGGAGCCATCCCAGGAGTTGTGGTTTGCCATTCCT

CTGGCTTGTACTTAGCTGCCATGCTTAAGCCATGCACATTGTTGCTGCTGTTACTTTTACCTCCTTCTCAGTAGATCATCTGAGGTCCAATTTTATAACA

GTTGTTATGATGGAGGATAGGAAGTGTGAATTGCCCAGACTTGTTAGGTTTTATGTCAAGAGGGAGTTGCAGTCACTGCAGCTACTTATATCACCAGAGC

TTAACTACTCTGGTTTAAATATAAGTAGTAATACTCATCTCTGCAGTTAGACACAGCTCTGTCCAGACTCAAGCTGGGCTGGTTGTAATTCAGCTTATGT

TAGCAGTGACTTTCAGAAAGATTAACTTAGGAGTTGATGACATGACCATGACCAGCATCCAGATACCACATTATGGGGGGTGGTTGTGCTGGTTAACCCA

TTGCTGGCAGTGGGAGCTGACTGAGGCAGGGTAAAGAAGCAAAGCATTACAGAGTTAAGAAAATTCACTACAGGTCTTTGATTTTTAACTTTTAAAGGGA

ACGTGGTTAAAGTGGTAACAAAACAGTTATCAACTCTCATCAGAAACCAGTCATTAGTTTACAGCTAGCACTTTGAAGTGAAATTAAATGAGGGGAGAGG

TCATATTGCCTGTGTCTGATAACCATGACTTTTTTTATGACATGTTTTACATATAAATTGCCCAGAAGATAGTGAGGGGTATTAATTAGAGTATGCTGTT

CACTTCGTGCATTACCTGCTGGGGGTACACTATAGCTTCTCCCTCAGGCACTTTTAAAAAACAAAATTTGCTTCTGTATCAAAAGAAAACAAATCAAGAG

TCATTCCTAAGGTAAAGCCAAAACTAGCCTGTAGGGCTTTAATGATATGATCCTTATAGAAAAGTCCAAAAAAAGGAGGAAAAAAAAAGGAAACTTGTAT

AAATTATTTTATTTATTATTGTAATTAGATCTTCACAATCAAAGCTGTCTTTTCACCATCTGTTTATTAATGTAAAACTGTAGTAATAAGCAAAAGTTGG

TTGCCTAGGGGAACAATAATTGTATATTCAGTTTAACAGAAATAAAAGAGTATTTGTCTTAAAATGCAAGATTTTGAGCCATGCAATTAAATTGTT
Translation
 - UNI6927 -  - UNI9572 - MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQNV - UNI3195 - - UNI11361 - VSENDQSFEVT

MTATTEVADDELSEGTVTQIQ - UNI23433 - ILQNDQLDEISPLGTEEVSAVSQAWFTTKEDKDSLTNKG - UNI33448 - GHKWKQGMWSKE

EIDILMNNIERYLK - UNI33448 - ARGIKDATEIIFEMSKDERKDFYRTIAWGLNRPLFAVYRRVLRMYDDRNHVGK - UNI33448 - KYTPE

EIEKLKE ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG GKWTEEEEKRLAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWL

NYLNWKQSGGTEWTKEDEINLILR RIAELDVADENDINWDLLAEGWSSVRSPQWLRSKWWTIKRQIANHKDVSFPV VYSMFRSESPAWKIIQPSLQAP

WQRCRFQSRSPTS LQQTPLLLLLTQKQSH    
Transcript ENSMUST00000115353
Sequence
TCACCCCAGCTGCAGCCACTCTCTCCCGCGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCCTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAAC

AGGAA - UNI6927 - AGGATCACAGATGCACAAGCATGGAGGAGAAGCAGTTTGGTTAACGTGAGTGATGCTGCTGGCCGAAGCACAGAGGTGGGAT

TCTATGGGAAGGCCTGTAGCTAATCCACCTGTGGTCTAG - UNI9572 - ATTTGAGTATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAG

AAACTGTGAACTCTGTGACGTTTACTCAGGACACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATG - UNI11361 - ACCCTGATGAAGTAGAC

TCAGAAGACAGTACTGAACCTCCACATAAGAGGCTTTGTTTGTCCTCTGAGGATGATCAAAGCATTGATGACGCTACGCCATGCATATCAGTCGTGGCAC

TCCCAC - UNI3195 - TTTCAGAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAGAGGTGGCAGATGATGAACTTTCTGAGGGAACTG

TGACACAAATTCAG - UNI23433 - ATTTTACAGAATGATCAACTAGATGAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCG

TGGTTTACAACTAAAGAAGATAAGGATTCTCTCACTAACAAAG - UNI33448 - GACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGA

TATTTTAATGAACAACATCGAGCGCTATCTGAAG - UNI33448 - GCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGATGTCAAAAGACG

AAAGAAAAGATTTCTACAGGACTATAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTTTATAGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGT

GGGAAA - UNI33448 - ATACACTCCTGAAGAGATCGAGAAGCTCAAGGA GCTCCGGATAAAACACGGCAATGACTGGGCAACAATAGGGGCGGCC

CTAGGAAGAAGTGCCTCTTCTGTCAAAGACCGCTGCCGGCTGATGAAGGATACCTGCAACACAG GGAAATGGACAGAAGAAGAAGAAAAGAGACTTGCA

GAGGTAGTTCATGAATTAACAAGCACGGAGCCAGGTGACATCGTCACACAGGGTGTGTCTTGGGCAGCTGTAGCTGAAAGAGTGGGTACCCGCTCAGAAA

AGCAATGCCGTTCTAAATGGCTCAACTACCTGAACTGGAAGCAGAGTGGGGGTACTGAATGGACCAAGGAAGATGAAATCAATCTCATCCTAAG GATAG

CTGAGCTTGATGTGGCCGATGAAAATGACATAAACTGGGATCTTTTAGCTGAAGGATGGAGCAGTGTCCGTTCACCACAGTGGCTTCGAAGTAAATGGTG

GACCATCAAAAGGCAAATTGCAAACCATAAGGATGTTTCATTTCCTG CTTCAACAGACTCCCCTGCTGCTTCTGTTGACTCAGAAACAATCACACTAAA

CAGTGGAACACTACAAACATTTGAGATTCTTCCA AAACGTAAACTCTTACTTCTGCATCTTGTTATGGGGACAAGGGGACATGCCTTAATGGTGATGGA

GGTCAAAGGATAA
Translation
 - UNI6927 -  - UNI9572 - MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND - UNI11361 - DPDEVDSEDSTEPPHKRLCLSSE

DDQSIDDATPCISVVALPL - UNI3195 - LSENDQSFEVTMTATTEVADDELSEGTVTQIQ - UNI23433 - ILQNDQLDEISPLGTEEVSAVS

QAWFTTKEDKDSLTNKG - UNI33448 - GHKWKQGMWSKEEIDILMNNIERYLK - UNI33448 - ARGIKDATEIIFEMSKDERKDFYRTIAWG

LNRPLFAVYRRVLRMYDDRNHVGK - UNI33448 - KYTPEEIEKLKE ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG GKWTEEEEKR

LAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILR RIAELDVADENDINWDLLAEGWSSVRSPQWLR

SKWWTIKRQIANHKDVSFPA ASTDSPAASVDSETITLNSGTLQTFEILP KRKLLLLHLVMGTRGHALMVMEVKG
Transcript ENSMUST00000095017
Sequence
TCACCCCAGCTGCAGCCACTCTCTCCCGCGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCCTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAAC

AGGAA - UNI6927 - AGGATCACAGATGCACAAGCATGGAGGAGAAGCAGTTTGGTTAACGTGAGTGATGCTGCTGGCCGAAGCACAGAGGTGGGAT

TCTATGGGAAGGCCTGTAGCTAATCCACCTGTGGTCTAG - UNI9572 - ATTTGAGTATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAG

AAACTGTGAACTCTGTGACGTTTACTCAGGACACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATG - UNI11361 - ACCCTGATGAAGTAGAC

TCAGAAGACAGTACTGAACCTCCACATAAGAGGCTTTGTTTGTCCTCTGAGGATGATCAAAGCATTGATGACGCTACGCCATGCATATCAGTCGTGGCAC

TCCCAC - UNI3195 - TTTCAGAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAGAGGTGGCAGATGATGAACTTTCTGAGGGAACTG

TGACACAAATTCAG - UNI23433 - ATTTTACAGAATGATCAACTAGATGAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCG

TGGTTTACAACTAAAGAAGATAAGGATTCTCTCACTAACAAAG - UNI33448 - GACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGA

TATTTTAATGAACAACATCGAGCGCTATCTGAAG - UNI33448 - GCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGATGTCAAAAGACG

AAAGAAAAGATTTCTACAGGACTATAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTTTATAGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGT

GGGAAA - UNI33448 - ATACACTCCTGAAGAGATCGAGAAGCTCAAGGA GCTCCGGATAAAACACGGCAATGACTGGGCAACAATAGGGGCGGCC

CTAGGAAGAAGTGCCTCTTCTGTCAAAGACCGCTGCCGGCTGATGAAGGATACCTGCAACACAG GGAAATGGACAGAAGAAGAAGAAAAGAGACTTGCA

GAGGTAGTTCATGAATTAACAAGCACGGAGCCAGGTGACATCGTCACACAGGGTGTGTCTTGGGCAGCTGTAGCTGAAAGAGTGGGTACCCGCTCAGAAA

AGCAATGCCGTTCTAAATGGCTCAACTACCTGAACTGGAAGCAGAGTGGGGGTACTGAATGGACCAAGGAAGATGAAATCAATCTCATCCTAAG GATAG

CTGAGCTTGATGTGGCCGATGAAAATGACATAAACTGGGATCTTTTAGCTGAAGGATGGAGCAGTGTCCGTTCACCACAGTGGCTTCGAAGTAAATGGTG

GACCATCAAAAGGCAAATTGCAAACCATAAGGATGTTTCATTTCCTG CTTCAACAGACTCCCCTGCTGCTTCTGTTGACTCAGAAACAATCACACTAAA

CAGTGGAACACTACAAACATTTGAGATTCTTCCA TCTTTCCATTTACAGCCCACTGGTACTCCAGGCACCTACCTTCTTCAAACAAGCTCAAGTCAAGG

CCTTCCCCTAACACTGACCACAAATCCCACAGTAACCCTGGCAGCTGCTGCTCCTGCTTCTCCTGAACAGATCATTGTTCATGCTTTATCC CCAGAACA

TTTGTTGAACACAAGCGATAATGTCACGGTACAATGTCACACACCAAGAGTCATCATTCAGACGGTAGCTACAGAGGACATCACTTCTTCATTATCCCAA

GAGGAACTGACAGTTGATAGTGATCTTCATTCATCTGATTTCCCTGAGCCTCCAGATGCACTAGAAGCAGACACTTTCCCAGACGAAATTCCTCGGCCTA

AGATGACTATACAACCATCATTTAATAATGCTCATGTATCTAAATTCAGCGACCAAAATAGCACAGAACTGATGAACAGTGTCATGGTCAGAACAGAGGA

AGAAATTGCCGACACTGACCTTAAGCAGGAAGAACCGCCGTCTGACTTAGCCAGTGCTTATGTTACTGAG GATTTAGAGTCTCCCACCATAGTGCACCA

AGTTCATCAGACAATTGATGATGAAACAATACTTATCGTTCCTTCACCTCATGGCTTTATCCAGGCATCTGATGTTATAGATACTGAATCTGTCTTGCCT

TTGACAACACTAACAG ATCCAATATTCCAGCATCATCAGGAAGCATCAAATATAATTGGATCATCTTTGGGCAGTCCTGTTTCTGAAGACTCAAAGGAT

GTTGAGGACTTAGTAAACTGTCACTAGATTATTAGAAACAGGTACTTCAAGAAGCCACATTGTGACTACATTGTCTCCAAAGAAAGGAGCCATCCCAGGA

GTTGTGGTTTGCCATTCCTCTGGCTTGTACTTAGCTGCCATGCTTAAGCCATGCACATTGTTGCTGCTGTTACTTTTACCTCCTTCTCAGTAGATCATCT

GAGGTCCAATTTTATAACAGTTGTTATGATGGAGGATAGGAAGTGTGAATTGCCCAGACTTGTTAGGTTTTATGTCAAGAGGGAGTTGCAGTCACTGCAG

CTACTTATATCACCAGAGCTTAACTACTCTGGTTTAAATATAAGTAGTAATACTCATCTCTGCAGTTAGACACAGCTCTGTCCAGACTCAAGCTGGGCTG

GTTGTAATTCAGCTTATGTTAGCAGTGACTTTCAGAAAGATTAACTTAGGAGTTGATGACATGACCATGACCAGCATCCAGATACCACATTATGGGGGGT

GGTTGTGCTGGTTAACCCATTGCTGGCAGTGGGAGCTGACTGAGGCAGGGTAAAGAAGCAAAGCATTACAGAGTTAAGAAAATTCACTACAGGTCTTTGA

TTTTTAACTTTTAAAGGGAACGTGGTTAAAGTGGTAACAAAACAGTTATCAACTCTCATCAGAAACCAGTCATTAGTTTACAGCTAGCACTTTGAAGTGA

AATTAAATGAGGGGAGAGGTCATATTGCCTGTGTCTGATAACCATGACTTTTTTTATGACATGTTTTACATATAAATTGCCCAGAAGATAGTGAGGGGTA

TTAATTAGAGTATGCTGTTCACTTCGTGCATTACCTGCTGGGGGTACACTATAGCTTCTCCCTCAGGCACTTTTAAAAAACAAAATTTGCTTCTGTATCA

AAAGAAAACAAATCAAGAGTCATTCCTAAGGTAAAGCCAAAACTAGCCTGTAGGGCTTTAATGATATGATCCTTATAGAAAAGTCCAAAAAAAGGAGGAA

AAAAAAAGGAAACTTGTATAAATTATTTTATTTATTATTGTAATTAGATCTTCACAATCAAAGCTGTCTTTTCACCATCTGTTTATTAATGTAAAACTGT

AGTAATAAGCAAAAGTTGGTTGCCTAGGGGAACAATAATTGTATATTCAGTTTAACAGAAATAAAAGAGTATTTGTCTTAAAATGCAAGATTTTGAGCCA

TGCAATTAAATTGTT
Translation
 - UNI6927 -  - UNI9572 - MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND - UNI11361 - DPDEVDSEDSTEPPHKRLCLSSE

DDQSIDDATPCISVVALPL - UNI3195 - LSENDQSFEVTMTATTEVADDELSEGTVTQIQ - UNI23433 - ILQNDQLDEISPLGTEEVSAVS

QAWFTTKEDKDSLTNKG - UNI33448 - GHKWKQGMWSKEEIDILMNNIERYLK - UNI33448 - ARGIKDATEIIFEMSKDERKDFYRTIAWG

LNRPLFAVYRRVLRMYDDRNHVGK - UNI33448 - KYTPEEIEKLKE ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG GKWTEEEEKR

LAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILR RIAELDVADENDINWDLLAEGWSSVRSPQWLR

SKWWTIKRQIANHKDVSFPA ASTDSPAASVDSETITLNSGTLQTFEILP SFHLQPTGTPGTYLLQTSSSQGLPLTLTTNPTVTLAAAAPASPEQIIVH

ALS PEHLLNTSDNVTVQCHTPRVIIQTVATEDITSSLSQEELTVDSDLHSSDFPEPPDALEADTFPDEIPRPKMTIQPSFNNAHVSKFSDQNSTELMNS

VMVRTEEEIADTDLKQEEPPSDLASAYVTE DLESPTIVHQVHQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTD DPIFQHHQEASNIIGSSLG

SPVSEDSKDVEDLVNCH
Transcript ENSMUST00000071921
Sequence
TCACCCCAGCTGCAGCCACTCTCTCCCGCGGCTGCTTCCTCCATCCTGGTATTTTTTGGAGCCTCCATCCTGGTTCTTCCAAAGTGCCCGGACCCAAAAC

AGGAA - UNI6927 - AGGATCACAGATGCACAAGCATGGAGGAGAAGCAGTTTGGTTAACGTGAGTGATGCTGCTGGCCGAAGCACAGAGGTGGGAT

TCTATGGGAAGGCCTGTAGCTAATCCACCTGTGGTCTAG - UNI9572 - ATTTGAGTATGAGCACAGTTGAAGAGGATTCTGACACAGTAACAGTAG

AAACTGTGAACTCTGTGACGTTTACTCAGGACACGGACGGGAATCTCATTCTTCATTGCCCTCAGAATG - UNI11361 - ACCCTGATGAAGTAGAC

TCAGAAGACAGTACTGAACCTCCACATAAGAGGCTTTGTTTGTCCTCTGAGGATGATCAAAGCATTGATGACGCTACGCCATGCATATCAGTCGTGGCAC

TCCCAC - UNI3195 - TTTCAGAAAATGATCAGAGCTTTGAGGTGACCATGACGGCAACTACAGAGGTGGCAGATGATGAACTTTCTGAGGGAACTG

TGACACAAATTCAG - UNI23433 - ATTTTACAGAATGATCAACTAGATGAAATATCTCCATTGGGTACTGAGGAAGTCTCAGCAGTTAGCCAAGCG

TGGTTTACAACTAAAGAAGATAAGGATTCTCTCACTAACAAAG - UNI33448 - GACATAAATGGAAGCAGGGGATGTGGTCCAAGGAAGAAATTGA

TATTTTAATGAACAACATCGAGCGCTATCTGAAG - UNI33448 - GCTCGCGGAATAAAAGATGCTACAGAAATCATCTTTGAGATGTCAAAAGACG

AAAGAAAAGATTTCTACAGGACTATAGCGTGGGGGCTGAACCGGCCTTTGTTTGCAGTTTATAGAAGAGTGCTGCGCATGTATGATGACAGGAACCATGT

GGGAAA - UNI33448 - ATACACTCCTGAAGAGATCGAGAAGCTCAAGGA GCTCCGGATAAAACACGGCAATGACTGGGCAACAATAGGGGCGGCC

CTAGGAAGAAGTGCCTCTTCTGTCAAAGACCGCTGCCGGCTGATGAAGGATACCTGCAACACAG GGAAATGGACAGAAGAAGAAGAAAAGAGACTTGCA

GAGGTAGTTCATGAATTAACAAGCACGGAGCCAGGTGACATCGTCACACAGGGTGTGTCTTGGGCAGCTGTAGCTGAAAGAGTGGGTACCCGCTCAGAAA

AGCAATGCCGTTCTAAATGGCTCAACTACCTGAACTGGAAGCAGAGTGGGGGTACTGAATGGACCAAGGAAGATGAAATCAATCTCATCCTAAG GATAG

CTGAGCTTGATGTGGCCGATGAAAATGACATAAACTGGGATCTTTTAGCTGAAGGATGGAGCAGTGTCCGTTCACCACAGTGGCTTCGAAGTAAATGGTG

GACCATCAAAAGGCAAATTGCAAACCATAAGGATGTTTCATTTCCTG TCCTAATAAAAGGTCTTAAACAGTTACATGAGAACCAAAAAAACAACCCAGT

GCTTTTGGAGAATAAATCAGGATCTGGAGTTCCAAACAGTAATTGCAATTCCAGTGTACAGCATGTTCAGATCAGAGTCGCCCGCTTGGAAGATAATACA

GCCATCTCTCCAAGCCCCATGGCAGCGTTGCAGATTCCAGTCCAGATCACCCACGTCT CTTCAACAGACTCCCCTGCTGCTTCTGTTGACTCAGAAACA

ATCACACTAAACAGTGGAACACTACAAACATTTGAGATTCTTCCA TCTTTCCATTTACAGCCCACTGGTACTCCAGGCACCTACCTTCTTCAAACAAGC

TCAAGTCAAGGCCTTCCCCTAACACTGACCACAAATCCCACAGTAACCCTGGCAGCTGCTGCTCCTGCTTCTCCTGAACAGATCATTGTTCATGCTTTAT

CC CCAGAACATTTGTTGAACACAAGCGATAATGTCACGGTACAATGTCACACACCAAGAGTCATCATTCAGACGGTAGCTACAGAGGACATCACTTCTT

CATTATCCCAAGAGGAACTGACAGTTGATAGTGATCTTCATTCATCTGATTTCCCTGAGCCTCCAGATGCACTAGAAGCAGACACTTTCCCAGACGAAAT

TCCTCGGCCTAAGATGACTATACAACCATCATTTAATAATGCTCATGTATCTAAATTCAGCGACCAAAATAGCACAGAACTGATGAACAGTGTCATGGTC

AGAACAGAGGAAGAAATTGCCGACACTGACCTTAAGCAGGAAGAACCGCCGTCTGACTTAGCCAGTGCTTATGTTACTGAG GATTTAGAGTCTCCCACC

ATAGTGCACCAAGTTCATCAGACAATTGATGATGAAACAATACTTATCGTTCCTTCACCTCATGGCTTTATCCAGGCATCTGATGTTATAGATACTGAAT

CTGTCTTGCCTTTGACAACACTAACAG ATCCAATATTCCAGCATCATCAGGAAGCATCAAATATAATTGGATCATCTTTGGGCAGTCCTGTTTCTGAAG

ACTCAAAGGATGTTGAGGACTTAGTAAACTGTCACTAGATTATTAGAAACAGGTACTTCAAGAAGCCACATTGTGACTACATTGTCTCCAAAGAAAGGAG

CCATCCCAGGAGTTGTGGTTTGCCATTCCTCTGGCTTGTACTTAGCTGCCATGCTTAAGCCATGCACATTGTTGCTGCTGTTACTTTTACCTCCTTCTCA

GTAGATCATCTGAGGTCCAATTTTATAACAGTTGTTATGATGGAGGATAGGAAGTGTGAATTGCCCAGACTTGTTAGGTTTTATGTCAAGAGGGAGTTGC

AGTCACTGCAGCTACTTATATCACCAGAGCTTAACTACTCTGGTTTAAATATAAGTAGTAATACTCATCTCTGCAGTTAGACACAGCTCTGTCCAGACTC

AAGCTGGGCTGGTTGTAATTCAGCTTATGTTAGCAGTGACTTTCAGAAAGATTAACTTAGGAGTTGATGACATGACCATGACCAGCATCCAGATACCACA

TTATGGGGGGTGGTTGTGCTGGTTAACCCATTGCTGGCAGTGGGAGCTGACTGAGGCAGGGTAAAGAAGCAAAGCATTACAGAGTTAAGAAAATTCACTA

CAGGTCTTTGATTTTTAACTTTTAAAGGGAACGTGGTTAAAGTGGTAACAAAACAGTTATCAACTCTCATCAGAAACCAGTCATTAGTTTACAGCTAGCA

CTTTGAAGTGAAATTAAATGAGGGGAGAGGTCATATTGCCTGTGTCTGATAACCATGACTTTTTTTATGACATGTTTTACATATAAATTGCCCAGAAGAT

AGTGAGGGGTATTAATTAGAGTATGCTGTTCACTTCGTGCATTACCTGCTGGGGGTACACTATAGCTTCTCCCTCAGGCACTTTTAAAAAACAAAATTTG

CTTCTGTATCAAAAGAAAACAAATCAAGAGTCATTCCTAAGGTAAAGCCAAAACTAGCCTGTAGGGCTTTAATGATATGATCCTTATAGAAAAGTCCAAA

AAAAGGAGGAAAAAAAAAGGAAACTTGTATAAATTATTTTATTTATTATTGTAATTAGATCTTCACAATCAAAGCTGTCTTTTCACCATCTGTTTATTAA

TGTAAAACTGTAGTAATAAGCAAAAGTTGGTTGCCTAGGGGAACAATAATTGTATATTCAGTTTAACAGAAATAAAAGAGTATTTGTCTTAAAATGCAAG

ATTTTGAGCCATGCAATTAAATTGTT
Translation
 - UNI6927 -  - UNI9572 - MSTVEEDSDTVTVETVNSVTFTQDTDGNLILHCPQND - UNI11361 - DPDEVDSEDSTEPPHKRLCLSSE

DDQSIDDATPCISVVALPL - UNI3195 - LSENDQSFEVTMTATTEVADDELSEGTVTQIQ - UNI23433 - ILQNDQLDEISPLGTEEVSAVS

QAWFTTKEDKDSLTNKG - UNI33448 - GHKWKQGMWSKEEIDILMNNIERYLK - UNI33448 - ARGIKDATEIIFEMSKDERKDFYRTIAWG

LNRPLFAVYRRVLRMYDDRNHVGK - UNI33448 - KYTPEEIEKLKE ELRIKHGNDWATIGAALGRSASSVKDRCRLMKDTCNTG GKWTEEEEKR

LAEVVHELTSTEPGDIVTQGVSWAAVAERVGTRSEKQCRSKWLNYLNWKQSGGTEWTKEDEINLILR RIAELDVADENDINWDLLAEGWSSVRSPQWLR

SKWWTIKRQIANHKDVSFPV VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS SSTDSPA

ASVDSETITLNSGTLQTFEILP SFHLQPTGTPGTYLLQTSSSQGLPLTLTTNPTVTLAAAAPASPEQIIVHALS PEHLLNTSDNVTVQCHTPRVIIQT

VATEDITSSLSQEELTVDSDLHSSDFPEPPDALEADTFPDEIPRPKMTIQPSFNNAHVSKFSDQNSTELMNSVMVRTEEEIADTDLKQEEPPSDLASAYV

TE DLESPTIVHQVHQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTD DPIFQHHQEASNIIGSSLGSPVSEDSKDVEDLVNCH

For any suggestions or comments, please send an email to unitrap@crg.es