Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042510 (AA986860)
Chromosomal location
Chr 1: 132628663 - 132641198 (+)
Description
Specifically androgen-regulated gene protein  [Source:UniProtKB/Swiss-Prot;Acc:Q8BI29]
Human Ortholog
not available
Omim not available
UniTrap UNI37828
Vector Insertion
Chr 1: 132634265 - 132637579
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039323
Sequence
ACCTGTCTAGGTAAGTCAGGAGGAGGTCAAAGGAAGAAACCAGTAGGAGACACGGCCTGAGAGGCAAGCGGTCTCCATCTCTGCCCTCTGGAATAGAAGG

GCATTACGTTCTTGTCTTCAGACCCCAACCCAGAGAAG GCCCAGCTTGGGACATTCTTCACTTCCATTCACTTCCCCTCTGGGAGCCCCTTTCACCACC

CCTGCGCCTTGCTTCAGGCGATGCCCAAGAGGGAGCTTTGGCCAGCAGGGCTGTGCTCAGAACCTGTGACCCACATCGGCAGCTGTGGCGACATGATGAG

CACCACCTCCACCCGCTCTGGATCT - UNI37828 - AGTGACAGCAGCTACGACTTCCTGTCTGCTGAAGAAAAGGAGTGTCTGCTCTTCCTGGAGA

AAACCATTGGCTCCCTGGAGGCTGAGGCTGACAGTGGGCTCTCCACAGACGAGTCAGAGCCAGCCACCAGTCCTCGGAGTTTCCGAGCCCTACCCACCGC

CACCCAACAGGCTCCCCAGG GAAAGCCAGAGGCCACAGACATTCAGCAGGTGCCAGTGCCAAAGAGAGTAGCCCAGCCCTCGTGTCCTCCTGAGTCTCA

CAGCCTGGGTCTCAGGGCTGGTTCCTACAGCCTTCCCAGAAACCTTCATCTTGGCCGAAGCCAGAACCTCAGGGAAAGCGCCACCCAGGCTAACAGCCCC

GTCTCTGAAGCATCTGAGGTATTCTTAGAGGAGCCTGAGAAAGGGCAGACCAGCCAGGGTGCTAAGGCTAAGACCATCCAGCCACCAGCCCCATCCCAGA

AGGGTACACTTGACCTGAGCACAGTTCTCATACCCCCGCCAGAAGCTTTCCAGGACATTAGACCAAAGGAAAGTGGGGAAGAGAGCCCACCTAAAAAGCC

AGGAGAACAGACACACACACCGCAGGTCCACTCTCTGGAGAGAAGTCCACATTCCCAGAAGAAAGTGGAAATGTCTTCTGAAACCGTATCCCATAAAGCC

ACTGAGAAAGGCTGGACAGAGGGGCTGCAGCAACCACAGCAGCCTCCGGCCCAGTCATCCCAGCCCACGAAAGCTGAAGAACTTTCTCTACCTTCAGGGG

TCAAGCCAAGCATCCAGCAGACTCCTCTCACAGCCTCAAAGGCCCGTAAGCTGCCACCTAATATAGTCCTGAAGAGCAGCAGAAGCAGTTTCCACAGCCA

TCCCCAGAACTGGCTGTCAAATCACACTGAAGCTACAGACTCGGGCCCTGTCTCTTCTTTGCAAGAACAAAGGAAAGCCCGCAGAGAGGCTCTGGAAAAG

CTAGGGCTGCCCCAGGACCAAGATGATCCCAGTCTGCTTGTAAATAAGCATACCAGTACCCTCAAAGTCAGGGAGGCTCAGCCTCAGACCCCTTCCCAGG

CCCGGGCTCCTGCTCGGCCAGCATCTCCAGCTCTGGTCTCGGGAACTGCTTCTGCGGCAGGGAAAGTGTCCCCGAAGAAGGCTGTCGCTCCTATGGACTC

TCTCAGCAAGGGTTGGATTCCTACCCAGGAAACCCCTCCAGGAAAGGTTGCAGAGGCCAAGTCTATGCCCATTCCTATCCCTAAGACCTTAAAGGAAAAC

AGTTCCCGGACACAGCCCAAGCCTGACCCACGGCTGACCCTCCAGGAAAGTAGCATCCCTGGCCTGAGACAGATGAACTTCAAGTCCAATACTCTGGAGC

GTTCAGGCGTAGGGCTGAGCAGCTATCTCTCAGCAGCTGAGAAAAAAGACCCCAGCTGCCAAACCAGCACATCTCTGGGAAAGAGCCCCTTCTTGGACAA

GGTTTCACCCAGCGCCTTTCGTAATTCCCGGCCCCGGCCTGCCTCCTTGGGCATGGGAAAGGATTTTGCAGGAATCCAGGGAGGCAAGCTGGTTGGCCTG

GAGCAGGACCAGTGCTCCCAGCAGCCATCCTTCAAAGGACAGAGTTATGACAAGCTTCCTCGACCCCCCTGTATCAGTGTCAAGATATCCCCAAAGGGCA

TTCCTGATGGGCACAGGAGGGAGGCTCTGAAGAAGCTGGGGCTGCTGAAGGAGTAGCATAGGCATGGCATAGCCCATGCCAACCTACCAGAAGAGACTGG

CTCTACCTAGAGCCTTTGCAGCCTCACAGCTCAGAGCTGGCTTCCTTCCTGTCTGAGGTGAAGAAGGAAGAGGCTTGAGGCCAAGGAGATGCCTGTACTC

AGGCAATTGTGCTATTGAGTACATGCGCAGATCATTATCAAGATGAGACTCACAGAAGGAGAGAGAGAGAGAGAGAGAGGTGGGGGGGGGCTTACATATC

ACTGACACTATTTATATAGCACAAGGAGTCACTGTTCAGAACTCTGCTCTTAGTTGAGATTTTCCAAGTGCAAAGTTCAGCCTGTCCCATAACTGAGTCG

AGCAGAGTGGCCAAACCTGAGAAGCAAAGTCAAAGGACACAAAGGATGCAGAAGCAACTTAAAAAGATGAATTTACACAGAGCATGAGACTACGGTGGCA

TGAAATACAGGCTGAGTTTCTGCAGTAACTGGAGTGAGACTGGCTTGTATTTGCTGTGCCCCTCTCTCAGGGCCTTCCAGACATGTCCTGAGGCCAAGGG

GATCTGGTTTGGTGTCTTTACCCACTGCCTTCCCTATCACTTCTTGCAGGCTAGGACGTATGCCTGTCTCTAGATCTCAAAGCCATTGATAGCAGGGGGC

CACTCCCTGGTCTGAGAAAACTGAATATATGGCCACACACTCCTCCATTTCTACCTGGAAGGATTCTTGTTGTCAGCTTGAAGAATACATTAATAAACTG

TGCCATGGCCCACG
Translation
 MPKRELWPAGLCSEPVTHIGSCGDMMSTTSTRSGS - UNI37828 - SDSSYDFLSAEEKECLLFLEKTIGSLEAEADSGLSTDESEPATSPRSFRA

LPTATQQAPQG GKPEATDIQQVPVPKRVAQPSCPPESHSLGLRAGSYSLPRNLHLGRSQNLRESATQANSPVSEASEVFLEEPEKGQTSQGAKAKTIQP

PAPSQKGTLDLSTVLIPPPEAFQDIRPKESGEESPPKKPGEQTHTPQVHSLERSPHSQKKVEMSSETVSHKATEKGWTEGLQQPQQPPAQSSQPTKAEEL

SLPSGVKPSIQQTPLTASKARKLPPNIVLKSSRSSFHSHPQNWLSNHTEATDSGPVSSLQEQRKARREALEKLGLPQDQDDPSLLVNKHTSTLKVREAQP

QTPSQARAPARPASPALVSGTASAAGKVSPKKAVAPMDSLSKGWIPTQETPPGKVAEAKSMPIPIPKTLKENSSRTQPKPDPRLTLQESSIPGLRQMNFK

SNTLERSGVGLSSYLSAAEKKDPSCQTSTSLGKSPFLDKVSPSAFRNSRPRPASLGMGKDFAGIQGGKLVGLEQDQCSQQPSFKGQSYDKLPRPPCISVK

ISPKGIPDGHRREALKKLGLLKE

For any suggestions or comments, please send an email to unitrap@crg.es