Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042520 (Ubap2l)
Chromosomal location
Chr 3: 89804064 - 89856394 (-)
Description
ubiquitin associated protein 2-like Gene [Source:MGI Symbol;Acc:MGI:1921633]
RefSeq_dna
NM_028475 
RefSeq_peptide
NP_082751.1 NP_705693.1 
UniGene
Mm.25610 
MGI
MGI:1921633 
Uniprot/SWISSPROT
Q80X50 
Uniprot/SPTREMBL
Q80U73 Q812D4 Q8BJ53 Q8BKR4 Q8BZ69 Q3TSB0 Q812D5 
Human Ortholog
ENSG00000143569 (UBAP2L)
Omim not available
UniTrap UNI18328
Vector Insertion
Chr 3: 89851822 - 89856311
Public Clones (sanger) E128B04 (ggtc) D003C01 (ggtc) D039E05 (ggtc) IST14591H3 (tigm)
Private Clones OST425576 (lexicon) OST200055 (lexicon) OST123526 (lexicon) OST96780 (lexicon)
OST78473 (lexicon) OST58593 (lexicon) OST56226 (lexicon) OST56155 (lexicon)
OST37620 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2000
Vector Insertion
Chr 3: 89848854 - 89851691
Public Clones BA0746 (sanger)
Private Clones OST80904 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23420
Vector Insertion
Chr 3: 89847733 - 89848775
Public Clones not available
Private Clones OST260495 (lexicon) OST226886 (lexicon) OST191661 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7210
Vector Insertion
Chr 3: 89842939 - 89847621
Public Clones RRU568 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12557
Vector Insertion
Chr 3: 89838623 - 89842291
Public Clones W067A04 (ggtc) PST8081-NL (escells) PST8081-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15127
Vector Insertion
Chr 3: 89835232 - 89838100
Public Clones PST12460-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3737
Vector Insertion
Chr 3: 89830601 - 89832246
Public Clones XS0549 (sanger) AC0721 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10833
Vector Insertion
Chr 3: 89829157 - 89830514
Public Clones D037D05 (ggtc) CMHD-GT_430D5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20846
Vector Insertion
Chr 3: 89827552 - 89828984
Public Clones not available
Private Clones OST350134 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5092
Vector Insertion
Chr 3: 89825439 - 89827352
Public Clones YTC653 (baygenomics) PST12117-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9044
Vector Insertion
Chr 3: 89824992 - 89825160
Public Clones XK301 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38612
Vector Insertion
Chr 3: 89823073 - 89824992
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7322
Vector Insertion
Chr 3: 89812284 - 89813031
Public Clones (sanger) RRU017 (baygenomics)
Private Clones OST91077 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27547
Vector Insertion
Chr 3: 89807235 - 89810141
Public Clones IST10910E1 (tigm) IST12597E12 (tigm)
Private Clones OST57104 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4126
Vector Insertion
Chr 3: 89806399 - 89807166
Public Clones AN0312 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28470
Vector Insertion
Chr 3: 89804136 - 89804176
Public Clones not available
Private Clones OST30231 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116319
Sequence
AGTGTGGAGGAGACTGAGGTAAAGTTGGGAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGG - UNI18328 - TAT

TCTTCCTTGTAAATACTGTTATTTGTATATACTGTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAAC

CAGACACAGCACAAGCAGCGGCCACAG - UNI2000 - GCCACTGCAGAGCAAATTCGACTTGCACAGATGATTTCGGACCATAATGATGCTGACTTT

GAGGAGAAGGTGAAACAA - UNI23420 - TTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGT

CAACAGAGCCATCAATGTTCTCCTGGAAGGAAATCCAGACACG - UNI7210 - CATTCCTGGGAGATGGTTGGGAAGAAGAAAGGAGTCTCAGGACA

AAAGGATGGTGGACAAACTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGACAGAGACTATAGTCGGCGACGTGGTGGGCCACCAAGACGGGGG

AGAGGTGCCAGCCGTGGACGAGAGT TTCGGGGCCAGGAAAATGGATTGGATGGCACCAAGAGTGGAGGGCCTTCTGGAAGAGGCACAGACAGAGGCAGA

AGAGGCCGTGGCCGTGGCAGAG - UNI12557 - GTAGTTCTGGTAGGCGAGGAGGAAGGTTTTCTGCTCAAGGAATGGG - UNI15127 - AACC

TTTAACCCAGCTGATTATGCAGAGCCAGCCAACACTGATGATAACTATGGCAATAGCAGTGGCAATACATGGAACAACACTGGCCACTTTGAACCAGATG

ATGGAACAA - UNI15127 - GTGCATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGACTGGAATGAAGAT - UNI3737 - CTTTCTGAGAC

CAAGATCTTTACCGCCTCTAATGTGTCTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTGCTGGTCAGAG - UNI10833 - AATTGACCTTG

CTGTTCTGTTGGGGAAGACACCATCTTCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCTCAGCCTCTGGTGTTTAGTAA

TTCGAAGCAGAATGCCATATCACAGCCTGCTTCAGGGAGTACATTTTCTCACCATAGCATG - UNI20846 - GTGAGCATGTTGGGGAAAGGATTTG

GTGATGTTGGGGAAGCTAAAGGTGGCAGTACAACAGGCTCCCAGTTCTTGGAGCAATTCAAGACTGCGCAGGCCCTTGCTCAACTGGCAGCTCAACATTC

TCAATCTGGAAGCACTACCACCTCCTCTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATG - UNI5092 - ATCTGAAGAGTGC

AAATGATTCAACAGTGCACAGTCCTTTTACAAAGCGCCAGGCATTCACCCCATCTTCAACCATGATGGAGGTATTCCTTCAGGAGAAGCCACCTGCAGTG

GCTACCTCGACAGCTGCACCACCTCCCCCGTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCAGACAACCAGTCCT

CCAGCCCTCAGCCGGCTCAGCAGAAACTGAAACAGCAAAAGAAGAAAACCTCCTTGACGTCTAAG - UNI9044 - ATTCCTGCTCTGGCTGTGGAGA

TGCCTGGCTCAGCAGATATCTCAGGGCTAAATCTACAGTTTGGGGCATTGCAGTTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGTCCACCCCCACCAC

GAGCGCCTCCTCAAGCCAGGCTCCTAGTAGCCTGTATACCAGCACGGCCAG TGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGTCTGGTTA

TCAGAGTGGCCCGATTCAGTCGACAACTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACGCGGCGGTATCCCAGC

TCCATCTCTTCATCACCCCAAAAGGACCTGACTCAGGCTAAG AATGGTTTTAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGTTGAAG G

TGCTACAGGCTCTGCAGTGAAATCTGAATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTGCAGCTTCCTTACTGACGACAGCCAAT

CAGCATTCATCCTCCTTAAGTGGCTTGAGCCATACGGAGGAGATTCCAAATACCACCACCACACAACATAGCAG TGCATTATCTACACAGCAGAATACC

CTTTCTTCATCAACATCTTCTGGGCGTACTTCAACATCCACTCTTTTG CATACAAGTGTGGAGAGTGAGGCAAATCTACATTCTTCCTCCAGCACCTTC

TCTACCACATCCAGCACTGTCTCTGCACCTCCCCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGTCTGGGCCTTAGCCTGGGCAGCAACT

CTACTGTCACAGCCTCAACTCGAAGCTCAGTTGCTACAACTTCAG GAAAAGCTCCTCCCAACCTTCCTCCTGGAGTCCCGCCATTGTTGCCTAATCCAT

ATATTATGGCTCCGGGGCTGTTACATGCCTATCCG CCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG GATTACTAC

AGTATCCCGTTTCCCACACCCACCACTCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTG GCGACCTCACCAAATTCGGCCGCGGG

GATGCCTCCTCCCCAGCCCCAGCCACAACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAACCCGGCGC

TGCCTCCTGGCTATAGTTACACCAGCCTGCCATACTACACAGGGGTCCCGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCT - UNI73

22 - GTGGCTCCTACCTCTTCCAAGCAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCTACCCCTTTCCAACAGCCAAGTGGATATGGGTCTCATGG

ATACAACACTG GAAGAAAATATCCACCCCCTTACAAGCATTTCTGGACGGCTGAGAGCTAATTTGGCCCAAGCCTGGGGGCTGTGTTTTGTGTGTGTGT

ATAAATTTGCACTGAAGTCTTGTTTCAGAAACCAGACCACTGAGGAGAGCCTGCTGAGCTGAGGCCATGGCCTGCGTGGCTTGGGGAAATGAGTTGGTGG

ATACCTTCTGGGCTTTTGAACTTGCCCGTTCCCCATTTCCCTCTCCCCCATATGTTTGACCCTGTCTTACCCATTTCGAGTTCGAGCCATGCAGCACCTC

CGAAGCATCAATGCACACACCTGCTGTTGCTTTTGATTTCTGGAAGGCATGTAGTTCCAACTTGTAACAAAATATTTGTAGTCTTCAATAAACTGTGGTA

TTTCTTTAGC
Translation
 - UNI18328 - MMTSVGTNRARGNWEQPQNQNQTQHKQRPQ - UNI2000 - ATAEQIRLAQMISDHNDADFEEKVKQ - UNI23420 - LID

ITGKNQDECVIALHDCNGDVNRAINVLLEGNPDT - UNI7210 - HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASR

GREF FRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRG - UNI12557 - GSSGRRGGRFSAQGMG - UNI15127 - GTFNPADYAEPANTDDNY

GNSSGNTWNNTGHFEPDDGTS - UNI15127 - SAWRTATEEWGTEDWNED - UNI3737 - LSETKIFTASNVSSVPLPAENVTITAGQR - UN

I10833 - RIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHHSM - UNI20846 - VSMLGKGFGDVGEAKGGST

TGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYD - UNI5092 - DLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVA

TSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK - UNI9044 - IPALAVEMPGSADISGLNLQFGALQFGSEPVLS

DYESTPTTSASSSQAPSSLYTSTAS SESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAK NGFSSVQAT

QLQTTQSVEG GATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTTTQHSS SALSTQQNTLSSSTSSGRTSTSTLL HTS

VESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSG GKAPPNLPPGVPPLLPNPYIMAPGLLHAYP PQVYG

YDDLQMLQTRFPL DYYSIPFPTPTTPLTGRDGSLASNPYSG GDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTG

VPGLPSTFQYGPAVFP - UNI7322 - VAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTG GRKYPPPYKHFWTAES
Transcript ENSMUST00000090908
Sequence
AGTGTGGAGGAGACTGAGGTAAAGTTGGGAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGG - UNI18328 - TAT

TCTTCCTTGTAAATACTGTTATTTGTATATACTGTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAAC

CAGACACAGCACAAGCAGCGGCCACAG - UNI2000 - GCCACTGCAGAGCAAATTCGACTTGCACAGATGATTTCGGACCATAATGATGCTGACTTT

GAGGAGAAGGTGAAACAA - UNI23420 - TTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGT

CAACAGAGCCATCAATGTTCTCCTGGAAGGAAATCCAGACACG - UNI7210 - CATTCCTGGGAGATGGTTGGGAAGAAGAAAGGAGTCTCAGGACA

AAAGGATGGTGGACAAACTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGACAGAGACTATAGTCGGCGACGTGGTGGGCCACCAAGACGGGGG

AGAGGTGCCAGCCGTGGACGAGAGTGTATGCATGGGGCTTTATCAAAACCAGCTGTGG TTCGGGGCCAGGAAAATGGATTGGATGGCACCAAGAGTGGA

GGGCCTTCTGGAAGAGGCACAGACAGAGGCAGAAGAGGCCGTGGCCGTGGCAGAG - UNI12557 - GTAGTTCTGGTAGGCGAGGAGGAAGGTTTTC

TGCTCAAGGAATGGG - UNI15127 - AACCTTTAACCCAGCTGATTATGCAGAGCCAGCCAACACTGATGATAACTATGGCAATAGCAGTGGCAATA

CATGGAACAACACTGGCCACTTTGAACCAGATGATGGAACAA - UNI15127 - GACTTGATTTCATTGGGGTTGAGGGGTCAAATTATCCCCGAAAA

TTTGAGACTGCTCCTG - UNI15127 - GTGCATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGACTGGAATGAAGAT - UNI3737 - CTTT

CTGAGACCAAGATCTTTACCGCCTCTAATGTGTCTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTGCTGGTCAGAG - UNI10833 - AATT

GACCTTGCTGTTCTGTTGGGGAAGACACCATCTTCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCTCAGCCTCTGGTGT

TTAGTAATTCGAAGCAGAATGCCATATCACAGCCTGCTTCAGGGAGTACATTTTCTCACCATAGCATG - UNI20846 - GTGAGCATGTTGGGGAAA

GGATTTGGTGATGTTGGGGAAGCTAAAGGTGGCAGTACAACAGGCTCCCAGTTCTTGGAGCAATTCAAGACTGCGCAGGCCCTTGCTCAACTGGCAGCTC

AACATTCTCAATCTGGAAGCACTACCACCTCCTCTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATG - UNI5092 - ATCTGA

AGAGTGCAAATGATTCAACAGTGCACAGTCCTTTTACAAAGCGCCAGGCATTCACCCCATCTTCAACCATGATGGAGGTATTCCTTCAGGAGAAGCCACC

TGCAGTGGCTACCTCGACAGCTGCACCACCTCCCCCGTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCAGACAAC

CAGTCCTCCAGCCCTCAGCCGGCTCAGCAGAAACTGAAACAGCAAAAGAAGAAAACCTCCTTGACGTCTAAG - UNI9044 - ATTCCTGCTCTGGCT

GTGGAGATGCCTGGCTCAGCAGATATCTCAGGGCTAAATCTACAGTTTGGGGCATTGCAGTTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGTCCACCC

CCACCACGAGCGCCTCCTCAAGCCAGGCTCCTAGTAGCCTGTATACCAGCACGGCCAG TGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGT

CTGGTTATCAGAGTGGCCCGATTCAGTCGACAACTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACGCGGCGGTA

TCCCAGCTCCATCTCTTCATCACCCCAAAAGGACCTGACTCAGGCTAAG AATGGTTTTAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGT

TGAAG GTGCTACAGGCTCTGCAGTGAAATCTGAATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTGCAGCTTCCTTACTGACGAC

AGCCAATCAGCATTCATCCTCCTTAAGTGGCTTGAGCCATACGGAGGAGATTCCAAATACCACCACCACACAACATAGCAG TGCATTATCTACACAGCA

GAATACCCTTTCTTCATCAACATCTTCTGGGCGTACTTCAACATCCACTCTTTTG CATACAAGTGTGGAGAGTGAGGCAAATCTACATTCTTCCTCCAG

CACCTTCTCTACCACATCCAGCACTGTCTCTGCACCTCCCCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGTCTGGGCCTTAGCCTGGGC

AGCAACTCTACTGTCACAGCCTCAACTCGAAGCTCAGTTGCTACAACTTCAG GAAAAGCTCCTCCCAACCTTCCTCCTGGAGTCCCGCCATTGTTGCCT

AATCCATATATTATGGCTCCGGGGCTGTTACATGCCTATCCG CCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG GA

TTACTACAGTATCCCGTTTCCCACACCCACCACTCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTG GCGACCTCACCAAATTCGG

CCGCGGGGATGCCTCCTCCCCAGCCCCAGCCACAACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAAC

CCGGCGCTGCCTCCTGGCTATAGTTACACCAGCCTGCCATACTACACAGGGGTCCCGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCT 

- UNI7322 - GTGGCTCCTACCTCTTCCAAGCAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCTACCCCTTTCCAACAGCCAAGTGGATATGGGT

CTCATGGATACAACACTG GAAGAAAATATCCACCCCCTTACAAGCATTTCTGGACGGCTGAGAGCTAATTTGGCCCAAGCCTGGGGGCTGTGTTTTGTG

TGTGTGTATAAATTTGCACTGAAGTCTTGTTTCAGAAACCAGACCACTGAGGAGAGCCTGCTGAGCTGAGGCCATGGCCTGCGTGGCTTGGGGAAATGAG

TTGGTGGATACCTTCTGGGCTTTTGAACTTGCCCGTTCCCCATTTCCCTCTCCCCCATATGTTTGACCCTGTCTTACCCATTTCGAGTTCGAGCCATGCA

GCACCTCCGAAGCATCAATGCACACACCTGCTGTTGCTTTTGATTTCTGGAAGGCATGTAGTTCCAACTTGTAACAAAATATTTGTAGTCTTCAATAAAC

TGTGGTATTTCTTTAGC
Translation
 - UNI18328 - MMTSVGTNRARGNWEQPQNQNQTQHKQRPQ - UNI2000 - ATAEQIRLAQMISDHNDADFEEKVKQ - UNI23420 - LID

ITGKNQDECVIALHDCNGDVNRAINVLLEGNPDT - UNI7210 - HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASR

GRECMHGALSKPAVV VRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRG - UNI12557 - GSSGRRGGRFSAQGMG - UNI15127 - GTFNPAD

YAEPANTDDNYGNSSGNTWNNTGHFEPDDGTR - UNI15127 - RLDFIGVEGSNYPRKFETAPG - UNI15127 - GAWRTATEEWGTEDWNED 

- UNI3737 - LSETKIFTASNVSSVPLPAENVTITAGQR - UNI10833 - RIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAIS

QPASGSTFSHHSM - UNI20846 - VSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYD - UNI

5092 - DLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK

 - UNI9044 - IPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTAS SESSSTVSSNQSQESGYQSGPIQSTTYT

SQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAK NGFSSVQATQLQTTQSVEG GATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGL

SHTEEIPNTTTTQHSS SALSTQQNTLSSSTSSGRTSTSTLL HTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTAST

RSSVATTSG GKAPPNLPPGVPPLLPNPYIMAPGLLHAYP PQVYGYDDLQMLQTRFPL DYYSIPFPTPTTPLTGRDGSLASNPYSG GDLTKFGRGDA

SSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFP - UNI7322 - VAPTSSKQHGVNVSVNASATPFQQP

SGYGSHGYNTG GRKYPPPYKHFWTAES
Transcript ENSMUST00000064639
Sequence
AGTGTGGAGGAGACTGAGGTAAAGTTGGGAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGG - UNI18328 - TAT

TCTTCCTTGTAAATACTGTTATTTGTATATACTGTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAAC

CAGACACAGCACAAGCAGCGGCCACAG - UNI2000 - GCCACTGCAGAGCAAATTCGACTTGCACAGATGATTTCGGACCATAATGATGCTGACTTT

GAGGAGAAGGTGAAACAA - UNI23420 - TTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGT

CAACAGAGCCATCAATGTTCTCCTGGAAGGAAATCCAGACACG - UNI7210 - CATTCCTGGGAGATGGTTGGGAAGAAGAAAGGAGTCTCAGGACA

AAAGGATGGTGGACAAACTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGACAGAGACTATAGTCGGCGACGTGGTGGGCCACCAAGACGGGGG

AGAGGTGCCAGCCGTGGACGAGAGT TTCGGGGCCAGGAAAATGGATTGGATGGCACCAAGAGTGGAGGGCCTTCTGGAAGAGGCACAGACAGAGGCAGA

AGAGGCCGTGGCCGTGGCAGAG - UNI12557 - GTAGTTCTGGTAGGCGAGGAGGAAGGTTTTCTGCTCAAGGAATGGG - UNI15127 - AACC

TTTAACCCAGCTGATTATGCAGAGCCAGCCAACACTGATGATAACTATGGCAATAGCAGTGGCAATACATGGAACAACACTGGCCACTTTGAACCAGATG

ATGGAACAA - UNI15127 - GACTTGATTTCATTGGGGTTGAGGGGTCAAATTATCCCCGAAAATTTGAGACTGCTCCTGGTATGATACATCCAG G

TGCATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGACTGGAATGAAGAT - UNI3737 - CTTTCTGAGACCAAGATCTTTACCGCCTCTAATGT

GTCTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTGCTGGTCAGAG - UNI10833 - AATTGACCTTGCTGTTCTGTTGGGGAAGACACCAT

CTTCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCTCAGCCTCTGGTGTTTAGTAATTCGAAGCAGAATGCCATATCACA

GCCTGCTTCAGGGAGTACATTTTCTCACCATAGCATG - UNI20846 - GTGAGCATGTTGGGGAAAGGATTTGGTGATGTTGGGGAAGCTAAAGGTG

GCAGTACAACAGGCTCCCAGTTCTTGGAGCAATTCAAGACTGCGCAGGCCCTTGCTCAACTGGCAGCTCAACATTCTCAATCTGGAAGCACTACCACCTC

CTCTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATG - UNI5092 - ATCTGAAGAGTGCAAATGATTCAACAGTGCACAGTCC

TTTTACAAAGCGCCAGGCATTCACCCCATCTTCAACCATGATGGAGGTATTCCTTCAGGAGAAGCCACCTGCAGTGGCTACCTCGACAGCTGCACCACCT

CCCCCGTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCAGACAACCAGTCCTCCAGCCCTCAGCCGGCTCAGCAGA

AACTGAAACAGCAAAAGAAGAAAACCTCCTTGACGTCTAAG - UNI9044 - ATTCCTGCTCTGGCTGTGGAGATGCCTGGCTCAGCAGATATCTCAG

GGCTAAATCTACAGTTTGGGGCATTGCAGTTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGTCCACCCCCACCACGAGCGCCTCCTCAAGCCAGGCTCC

TAGTAGCCTGTATACCAGCACGGCCAG TGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGTCTGGTTATCAGAGTGGCCCGATTCAGTCGAC

AACTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACGCGGCGGTATCCCAGCTCCATCTCTTCATCACCCCAAAAG

GACCTGACTCAGGCTAAG AATGGTTTTAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGTTGAAG GTGCTACAGGCTCTGCAGTGAAATC

TGAATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTGCAGCTTCCTTACTGACGACAGCCAATCAGCATTCATCCTCCTTAAGTGGC

TTGAGCCATACGGAGGAGATTCCAAATACCACCACCACACAACATAGCAG TGCATTATCTACACAGCAGAATACCCTTTCTTCATCAACATCTTCTGGG

CGTACTTCAACATCCACTCTTTTG CATACAAGTGTGGAGAGTGAGGCAAATCTACATTCTTCCTCCAGCACCTTCTCTACCACATCCAGCACTGTCTCT

GCACCTCCCCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGTCTGGGCCTTAGCCTGGGCAGCAACTCTACTGTCACAGCCTCAACTCGAA

GCTCAGTTGCTACAACTTCAG GAAAAGCTCCTCCCAACCTTCCTCCTGGAGTCCCGCCATTGTTGCCTAATCCATATATTATGGCTCCGGGGCTGTTAC

ATGCCTATCCG CCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG GATTACTACAGTATCCCGTTTCCCACACCCACC

ACTCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTG GCGACCTCACCAAATTCGGCCGCGGGGATGCCTCCTCCCCAGCCCCAGCC

ACAACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAACCCGGCGCTGCCTCCTGGCTATAGTTACACCA

GCCTGCCATACTACACAGGGGTCCCGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCT - UNI7322 - GTGGCTCCTACCTCTTCCA

AGCAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCTACCCCTTTCCAACAGCCAAGTGGATATGGGTCTCATGGATACAACACTG - UNI27547 -

 GTGTGTCAGTCACCTCCAGTAACACGGGCGTGCCAGATATATCCGGTTCTGTGTACTCCAAAACCCAG - UNI4126 - CAGTCCTTTGAGAAACAA

GGGTTTCATTCCGGTACTCCTGCTGCCTCCTTCAACTTGCCTTCAGCCCTAGGAAGTGGAGGGCCCATCAATCCAGCCACAGCTGCTGCCTACCCACCTG

CCCCCTTTATGCATATTCTGACCCCACATCAGCAGCCACACTCTCAGATCCTTCACCATCACCTGCAGCAGGATGGCCAG ACGGGCAGCGGGCAACGTA

GCCAGACCAGCTCCATCCCGCAGAAGCCCCAGACCAACAAGTCTGCCTACAACAGCTACAGCTGGGGGGCCAACTGA
Translation
 - UNI18328 - MMTSVGTNRARGNWEQPQNQNQTQHKQRPQ - UNI2000 - ATAEQIRLAQMISDHNDADFEEKVKQ - UNI23420 - LID

ITGKNQDECVIALHDCNGDVNRAINVLLEGNPDT - UNI7210 - HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASR

GREF FRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRG - UNI12557 - GSSGRRGGRFSAQGMG - UNI15127 - GTFNPADYAEPANTDDNY

GNSSGNTWNNTGHFEPDDGTR - UNI15127 - RLDFIGVEGSNYPRKFETAPGMIHPG GAWRTATEEWGTEDWNED - UNI3737 - LSETKIF

TASNVSSVPLPAENVTITAGQR - UNI10833 - RIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHHSM - UNI

20846 - VSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYD - UNI5092 - DLKSANDSTVHS

PFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK - UNI9044 - IPALAV

EMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTAS SESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRR

YPSSISSSPQKDLTQAK NGFSSVQATQLQTTQSVEG GATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTTTQHSS SA

LSTQQNTLSSSTSSGRTSTSTLL HTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSG GKAPPNLPP

GVPPLLPNPYIMAPGLLHAYP PQVYGYDDLQMLQTRFPL DYYSIPFPTPTTPLTGRDGSLASNPYSG GDLTKFGRGDASSPAPATTLAQPQQNQTQT

HHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFP - UNI7322 - VAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTG - UNI27

547 - GVSVTSSNTGVPDISGSVYSKTQ - UNI4126 - QSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILH

HHLQQDGQ TGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN
Transcript ENSMUST00000029553
Sequence
AGTGTGGAGGAGACTGAGGTAAAGTTGGGAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGG - UNI18328 - TAT

TCTTCCTTGTAAATACTGTTATTTGTATATACTGTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAAC

CAGACACAGCACAAGCAGCGGCCACAG - UNI2000 - GCCACTGCAGAGCAAATTCGACTTGCACAGATGATTTCGGACCATAATGATGCTGACTTT

GAGGAGAAGGTGAAACAA - UNI23420 - TTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGT

CAACAGAGCCATCAATGTTCTCCTGGAAGGAAATCCAGACACG - UNI7210 - CATTCCTGGGAGATGGTTGGGAAGAAGAAAGGAGTCTCAGGACA

AAAGGATGGTGGACAAACTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGACAGAGACTATAGTCGGCGACGTGGTGGGCCACCAAGACGGGGG

AGAGGTGCCAGCCGTGGACGAGAGT TTCGGGGCCAGGAAAATGGATTGGATGGCACCAAGAGTGGAGGGCCTTCTGGAAGAGGCACAGACAGAGGCAGA

AGAGGCCGTGGCCGTGGCAGAG - UNI12557 - GTAGTTCTGGTAGGCGAGGAGGAAGGTTTTCTGCTCAAGGAATGGG - UNI15127 - AACC

TTTAACCCAGCTGATTATGCAGAGCCAGCCAACACTGATGATAACTATGGCAATAGCAGTGGCAATACATGGAACAACACTGGCCACTTTGAACCAGATG

ATGGAACAA - UNI15127 - GACTTGATTTCATTGGGGTTGAGGGGTCAAATTATCCCCGAAAATTTGAGACTGCTCCTG - UNI15127 - GTG

CATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGACTGGAATGAAGAT - UNI3737 - CTTTCTGAGACCAAGATCTTTACCGCCTCTAATGTGT

CTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTGCTGGTCAGAG - UNI10833 - AATTGACCTTGCTGTTCTGTTGGGGAAGACACCATCT

TCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCTCAGCCTCTGGTGTTTAGTAATTCGAAGCAGAATGCCATATCACAGC

CTGCTTCAGGGAGTACATTTTCTCACCATAGCATG - UNI20846 - GTGAGCATGTTGGGGAAAGGATTTGGTGATGTTGGGGAAGCTAAAGGTGGC

AGTACAACAGGCTCCCAGTTCTTGGAGCAATTCAAGACTGCGCAGGCCCTTGCTCAACTGGCAGCTCAACATTCTCAATCTGGAAGCACTACCACCTCCT

CTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATG - UNI5092 - ATCTGAAGAGTGCAAATGATTCAACAGTGCACAGTCCTT

TTACAAAGCGCCAGGCATTCACCCCATCTTCAACCATGATGGAGGTATTCCTTCAGGAGAAGCCACCTGCAGTGGCTACCTCGACAGCTGCACCACCTCC

CCCGTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCAGACAACCAGTCCTCCAGCCCTCAGCCGGCTCAGCAGAAA

CTGAAACAGCAAAAGAAGAAAACCTCCTTGACGTCTAAG - UNI9044 - ATTCCTGCTCTGGCTGTGGAGATGCCTGGCTCAGCAGATATCTCAGGG

CTAAATCTACAGTTTGGGGCATTGCAGTTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGTCCACCCCCACCACGAGCGCCTCCTCAAGCCAGGCTCCTA

GTAGCCTGTATACCAGCACGGCCAG TGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGTCTGGTTATCAGAGTGGCCCGATTCAGTCGACAA

CTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACGCGGCGGTATCCCAGCTCCATCTCTTCATCACCCCAAAAGGA

CCTGACTCAGGCTAAG AATGGTTTTAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGTTGAAG GTGCTACAGGCTCTGCAGTGAAATCTG

AATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTGCAGCTTCCTTACTGACGACAGCCAATCAGCATTCATCCTCCTTAAGTGGCTT

GAGCCATACGGAGGAGATTCCAAATACCACCACCACACAACATAGCAG TGCATTATCTACACAGCAGAATACCCTTTCTTCATCAACATCTTCTGGGCG

TACTTCAACATCCACTCTTTTG CATACAAGTGTGGAGAGTGAGGCAAATCTACATTCTTCCTCCAGCACCTTCTCTACCACATCCAGCACTGTCTCTGC

ACCTCCCCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGTCTGGGCCTTAGCCTGGGCAGCAACTCTACTGTCACAGCCTCAACTCGAAGC

TCAGTTGCTACAACTTCAG GAAAAGCTCCTCCCAACCTTCCTCCTGGAGTCCCGCCATTGTTGCCTAATCCATATATTATGGCTCCGGGGCTGTTACAT

GCCTATCCG CCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG GATTACTACAGTATCCCGTTTCCCACACCCACCAC

TCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTG GCGACCTCACCAAATTCGGCCGCGGGGATGCCTCCTCCCCAGCCCCAGCCAC

AACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAACCCGGCGCTGCCTCCTGGCTATAGTTACACCAGC

CTGCCATACTACACAGGGGTCCCGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCT - UNI7322 - GTGGCTCCTACCTCTTCCAAG

CAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCTACCCCTTTCCAACAGCCAAGTGGATATGGGTCTCATGGATACAACACTG - UNI27547 - G

TGTGTCAGTCACCTCCAGTAACACGGGCGTGCCAGATATATCCGGTTCTGTGTACTCCAAAACCCAG - UNI4126 - CAGTCCTTTGAGAAACAAGG

GTTTCATTCCGGTACTCCTGCTGCCTCCTTCAACTTGCCTTCAGCCCTAGGAAGTGGAGGGCCCATCAATCCAGCCACAGCTGCTGCCTACCCACCTGCC

CCCTTTATGCATATTCTGACCCCACATCAGCAGCCACACTCTCAGATCCTTCACCATCACCTGCAGCAGGATGGCCAG CTACCATATTTGCAGATGATT

CTCTGTTGCCAGCGCCAGCAGGAGGAGCAG - UNI28470 - GATATCCTCACTCTCGTCGATGACCAGCTTGGTGAATAA
Translation
 - UNI18328 - MMTSVGTNRARGNWEQPQNQNQTQHKQRPQ - UNI2000 - ATAEQIRLAQMISDHNDADFEEKVKQ - UNI23420 - LID

ITGKNQDECVIALHDCNGDVNRAINVLLEGNPDT - UNI7210 - HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASR

GREF FRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRG - UNI12557 - GSSGRRGGRFSAQGMG - UNI15127 - GTFNPADYAEPANTDDNY

GNSSGNTWNNTGHFEPDDGTR - UNI15127 - RLDFIGVEGSNYPRKFETAPG - UNI15127 - GAWRTATEEWGTEDWNED - UNI3737 -

 LSETKIFTASNVSSVPLPAENVTITAGQR - UNI10833 - RIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHH

SM - UNI20846 - VSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYD - UNI5092 - DLKS

ANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK - UNI9044 

- IPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTAS SESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYE

QRSTQTRRYPSSISSSPQKDLTQAK NGFSSVQATQLQTTQSVEG GATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTT

TQHSS SALSTQQNTLSSSTSSGRTSTSTLL HTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSG G

KAPPNLPPGVPPLLPNPYIMAPGLLHAYP PQVYGYDDLQMLQTRFPL DYYSIPFPTPTTPLTGRDGSLASNPYSG GDLTKFGRGDASSPAPATTLAQ

PQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFP - UNI7322 - VAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTG

 - UNI27547 - GVSVTSSNTGVPDISGSVYSKTQ - UNI4126 - QSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQ

QPHSQILHHHLQQDGQ LPYLQMILCCQRQQEEQ - UNI28470 - DILTLVDDQLGE
Transcript ENSMUST00000080538
Sequence
GGTAAAGTTGGGAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGG - UNI18328 - TATTCTTCCTTGTAAATACT

GTTATTTGTATATACTGTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAACCAGACACAGCACAAGCA

GCGGCCACAG - UNI2000 - GCCACTGCAGAGCAAATTCGACTTGCACAGATGATTTCGGACCATAATGATGCTGACTTTGAGGAGAAGGTGAAACA

A - UNI23420 - TTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGTCAACAGAGCCATCAATG

TTCTCCTGGAAGGAAATCCAGACACG - UNI7210 - CATTCCTGGGAGATGGTTGGGAAGAAGAAAGGAGTCTCAGGACAAAAGGATGGTGGACAAA

CTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGACAGAGACTATAGTCGGCGACGTGGTGGGCCACCAAGACGGGGGAGAGGTGCCAGCCGTGG

ACGAGAGT TTCGGGGCCAGGAAAATGGATTGGATGGCACCAAGAGTGGAGGGCCTTCTGGAAGAGGCACAGACAGAGGCAGAAGAGGCCGTGGCCGTGG

CAGAG - UNI12557 - GTAGTTCTGGTAGGCGAGGAGGAAGGTTTTCTGCTCAAGGAATGGG - UNI15127 - AACCTTTAACCCAGCTGATTA

TGCAGAGCCAGCCAACACTGATGATAACTATGGCAATAGCAGTGGCAATACATGGAACAACACTGGCCACTTTGAACCAGATGATGGAACAA - UNI15

127 - GTGCATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGACTGGAATGAAGAT - UNI3737 - CTTTCTGAGACCAAGATCTTTACCGCCT

CTAATGTGTCTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTGCTGGTCAGAG - UNI10833 - AATTGACCTTGCTGTTCTGTTGGGGAAG

ACACCATCTTCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCTCAGCCTCTGGTGTTTAGTAATTCGAAGCAGAATGCCA

TATCACAGCCTGCTTCAGGGAGTACATTTTCTCACCATAGCATG - UNI20846 - GTGAGCATGTTGGGGAAAGGATTTGGTGATGTTGGGGAAGCT

AAAGGTGGCAGTACAACAGGCTCCCAGTTCTTGGAGCAATTCAAGACTGCGCAGGCCCTTGCTCAACTGGCAGCTCAACATTCTCAATCTGGAAGCACTA

CCACCTCCTCTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATG - UNI5092 - ATCTGAAGAGTGCAAATGATTCAACAGTGC

ACAGTCCTTTTACAAAGCGCCAGGCATTCACCCCATCTTCAACCATGATGGAGGTATTCCTTCAGGAGAAGCCACCTGCAGTGGCTACCTCGACAGCTGC

ACCACCTCCCCCGTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCAGACAACCAGTCCTCCAGCCCTCAGCCGGCT

CAGCAGAAACTGAAACAGCAAAAGAAGAAAACCTCCTTGACGTCTAAG - UNI9044 - ATTCCTGCTCTGGCTGTGGAGATGCCTGGCTCAGCAGAT

ATCTCAGGGCTAAATCTACAGTTTGGGGCATTGCAGTTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGTCCACCCCCACCACGAGCGCCTCCTCAAGCC

AGGCTCCTAGTAGCCTGTATACCAGCACGGCCAG TGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGTCTGGTTATCAGAGTGGCCCGATTC

AGTCGACAACTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACGCGGCGGTATCCCAGCTCCATCTCTTCATCACC

CCAAAAGGACCTGACTCAGGCTAAG AATGGTTTTAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGTTGAAG GTGCTACAGGCTCTGCAG

TGAAATCTGAATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTGCAGCTTCCTTACTGACGACAGCCAATCAGCATTCATCCTCCTT

AAGTGGCTTGAGCCATACGGAGGAGATTCCAAATACCACCACCACACAACATAGCAG TGCATTATCTACACAGCAGAATACCCTTTCTTCATCAACATC

TTCTGGGCGTACTTCAACATCCACTCTTTTG CATACAAGTGTGGAGAGTGAGGCAAATCTACATTCTTCCTCCAGCACCTTCTCTACCACATCCAGCAC

TGTCTCTGCACCTCCCCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGTCTGGGCCTTAGCCTGGGCAGCAACTCTACTGTCACAGCCTCA

ACTCGAAGCTCAGTTGCTACAACTTCAG GAAAAGCTCCTCCCAACCTTCCTCCTGGAGTCCCGCCATTGTTGCCTAATCCATATATTATGGCTCCGGGG

CTGTTACATGCCTATCCG CCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG GATTACTACAGTATCCCGTTTCCCAC

ACCCACCACTCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTG GCGACCTCACCAAATTCGGCCGCGGGGATGCCTCCTCCCCAGC

CCCAGCCACAACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAACCCGGCGCTGCCTCCTGGCTATAGT

TACACCAGCCTGCCATACTACACAGGGGTCCCGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCT - UNI7322 - GTGGCTCCTACC

TCTTCCAAGCAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCTACCCCTTTCCAACAGCCAAGTGGATATGGGTCTCATGGATACAACACTG - UNI

27547 - GTGTGTCAGTCACCTCCAGTAACACGGGCGTGCCAGATATATCCGGTTCTGTGTACTCCAAAACCCAG - UNI4126 - TCCTTTGAGAA

ACAAGGGTTTCATTCCGGTACTCCTGCTGCCTCCTTCAACTTGCCTTCAGCCCTAGGAAGTGGAGGGCCCATCAATCCAGCCACAGCTGCTGCCTACCCA

CCTGCCCCCTTTATGCATATTCTGACCCCACATCAGCAGCCACACTCTCAGATCCTTCACCATCACCTGCAGCAGGATGGCCAG - UNI28470 - GA

TATCCTCACTCTCGTCGATGACCAGCTTGGTGAATAAGTATTACCGTACCAACTGGGGCCTCTTCTAGCAGGCTCGAAGGCTGTGGAATAAAGTGAAATC

TTTGCCCTTT
Translation
 - UNI18328 - MMTSVGTNRARGNWEQPQNQNQTQHKQRPQ - UNI2000 - ATAEQIRLAQMISDHNDADFEEKVKQ - UNI23420 - LID

ITGKNQDECVIALHDCNGDVNRAINVLLEGNPDT - UNI7210 - HSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASR

GREF FRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRG - UNI12557 - GSSGRRGGRFSAQGMG - UNI15127 - GTFNPADYAEPANTDDNY

GNSSGNTWNNTGHFEPDDGTS - UNI15127 - SAWRTATEEWGTEDWNED - UNI3737 - LSETKIFTASNVSSVPLPAENVTITAGQR - UN

I10833 - RIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHHSM - UNI20846 - VSMLGKGFGDVGEAKGGST

TGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYD - UNI5092 - DLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVA

TSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK - UNI9044 - IPALAVEMPGSADISGLNLQFGALQFGSEPVLS

DYESTPTTSASSSQAPSSLYTSTAS SESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAK NGFSSVQAT

QLQTTQSVEG GATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTTTQHSS SALSTQQNTLSSSTSSGRTSTSTLL HTS

VESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSG GKAPPNLPPGVPPLLPNPYIMAPGLLHAYP PQVYG

YDDLQMLQTRFPL DYYSIPFPTPTTPLTGRDGSLASNPYSG GDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTG

VPGLPSTFQYGPAVFP - UNI7322 - VAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTG - UNI27547 - GVSVTSSNTGVPDISGSVYSK

TQ - UNI4126 - SFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQ - UNI28470 - DILTLV

DDQLGE

For any suggestions or comments, please send an email to unitrap@crg.es