Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042567 (Nek10)
Chromosomal location
Chr 14: 15653279 - 15833718 (+)
Description
NIMA (never in mitosis gene a)- related kinase 10 Gene [Source:MGI (curated);Acc:Nek10-001]
RefSeq_dna
NM_001034865 
RefSeq_peptide
NP_001030037.1 
UniGene
Mm.317563 
MGI
MGI:2685128 
Uniprot/SWISSPROT
Q3UGM2 
Human Ortholog
ENSG00000163491 (NEK10)
Omim not available
UniTrap UNI33748
Vector Insertion
Chr 14: 15819292 - 15831597
Public Clones IST14694E11 (tigm) IST14824E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063220
Sequence
GACTGCCCCAAGGGCAGCTCTGTGCTCTGCCAGCATTCAGTGGATCCTGACACTAAGTTTTCCGTTTTGTGCTCCAACACTCCTTGGAAAGCCCGGGTTC

TAATTTGTGAAGGTTTTCCAGGGCTTTATACTGACTTTACATTTCTGTGACTCCTTTTTGCTTTTGCATAGATGACAGGTTGTATATCGTTATGGAGCTG

ATAGAAGGAGCCCCACTTGGAGAGCACTTTAATTCTTTGAAGGAAAAACATCACCATTTCAGTGAAGAGCGACTGTGGAAAATATTTATACAG CTGTGC

TTAGCTCTTCGGTATCTGCACAAGGAGAAGAGGATTGTTCACAGAGATCTCACGCCAAACAACATTATGCTGGGAGATAAGGACAAAGTGACAGTTA CT

GACTTTGGCCTGGCAAAGCAAAAACAGGAAAGCAGTAAGCTTACATCTATGGTGGGAACGATCCTCTATTCTTG CCCAGAGGTCCTGAAGAGTGAGCCA

TATGGAGAGAAGGCCGATGTCTGGGCTGCTGGCTGCATCCTTTATCAGATGGCGACTCTAAGTCCTCCCTTCTGTAGCACCAACATGCTCTCCTTGGCTA

CTAAA ATAGTGGAGGCTGTATATGAGCCAGTGCCAGAAGGTATCTACTCTGAAAAAGTGACAGATACCATTAGAAG GTGCCTCACTCCTGATGCAGAA

GCCCGTCCAGATATTGTAGAAGTTAGTTCCATGATATCAGATGTCATGATGAAGTATTTAGACAGATTATCCACATCCCAGCTAGCCTTGGAGAGGAAAC

TGGAAAGGGAGCGGAGGCGCACACAGAGATACTTTATGGAAGCCAACAGGAATGCTGTCACATGTCACCATGAGCTGGCTCTTCTGTCCCAG GAGACCT

TTGAGAAGGCAAGCCTGAGCAGCAGTAGCAGCGGGGCAGCCAGCCTGAAAAGTGAGCTTTCAGAGAGCGCAGAGCTGCCTGGAGAGGGCTGCCACATCCC

CTGCGGGAAGGAGGAGGACAGGGTCTGTGAGGAGGTGCTGTCAGAAGACAACTTCCAGCTGGAGAGTGTGGAGAAAG ACCTGTATTCTGAGCTAGACGA

TGAGCTGGACGTCTCGGACAACTGTAGCAGCTCCAGTTCAAGCCCCCTAAAGGAGTCTACATTCA GCATTTTAAAGCGAAGTTTCAGTGCTTCGGGAAG

AGAAAGGCACTCACAGGCAAG GGACTTCATTGCTGGACTAGGATCAAGACCAAGACCAG CTTTGCTGCCCCTCCACCTGCTTGGGAAAGTGCCACACC

AATGCCCAGGGACCACTTAAGGAAGGAGCGGACAAGTCAGTGCAGGGTGGCAGTTCCAGAGCCTGCCTGCTGTGACTCTCCACAGTCCCAAACATCATGG

CAATGCCCAGCAAATCATTTTGATATTAAGTACATAACTACTTAACACAAGTTGAGCCTAATGTATCTTGAATGATTCTCCAGGAAGAACTGTGACACAT

AGCAGATTTCTGACTGGCACCAAATGAACAAAAAATTTAGGCTGTTTTTCCAAAAATTGCCTTTCTGCCTTCTTGAAGCTATTAATTACTTAAGTTATAA

AGTATGTATAACTATTCCAAAAAATAATGACAGTTTTATATAGATATTTGAAAACTCAACCTCTCCAATGCTAGGAGATTCCCTCCCCCCCTTTTTTTAC

TTGACATAGTTTTTCTTTTTTGCTCTGACACAGTTACTTTTCTAGACAGTTATTTTTGCTTGGTTGAAATGAAATTATTCCATAATTTCTTTAAATTAAA

AATTATCCTTAGAATTTATTTTACCTGTATTAGTCTGTCTGGACGTATGTACATGCATACAAGCCAGGGAGCCAGTGAGTGGTATCAGGTGTCTCCTTCC

ATGGCAGTTACAAGGGACTGAACTCATATCACTGGGCTTGAAGAGCAAGGGACTTTACCCATTGAGCCATCTCACCAACCCCAAATTATGTCATGAGACA

TAAATGTGCAATGATGCTGTGGGATGAGAAGGATAGGTTTCTAATTTCTAGTAAGGACAATTAAGGAAGACTGGTGTCCAATAGTAACCATAAAATTATC

AACTAAGTGTAGACAGTGCCACAGATGCTTTATGACTCTGCTTTGAACCTATGAAAGAGGAGGATGCTTGAGCAGCATGTTCTATTTTAATATACAGGCT

ATTTGGAATTACTCTTCTGTGCAGTTTCACTTTTACTCCTTAATTAATCTTGTTTGGTTCATTTAATGTTTTCACTGATAATGTGGGTGGAGTTTCAGTC

ATTTTAGGCTGTGTGTCTCCAGTCATTATATTTCCTTGGAAAGTGTTACAGACTTTCACAGTTTAAGGCTGTCACAATGTCAGCATAGATGCTAAGTAAG

ATGGTTGTATTGTTAAAATGCCCAAAAGTACCACATGGACCCTCACTGCCATGCTGCTAACCTGGCAAAGGTGAGATAAGAGTGTAATAAGTGTGTGTGG

GTCTAGATAATTGCTGTTTTCATCTCTTTAACAGTGAGAGCAGAGCTCTTACACATGTAAACAACCATGGACCTGTGCGGTTCATCATAGGGATTCATTT

TTTTCTGAAGGGTGGGTTAAGTTTGTATGGTATAACGTTTGGTTTTAAGAAAATGATTTATACTACAAATTTAGATATGATCTCTTTATACTTTGCCTTG

CCTGAAAGCTGCTGTTACCTGGAAGAGAAAACACTCAATCCAGGTCTCTGCCTGCAGCTCTAGGCCTTTGTCACTGTCCATGTGGCTTCTGCTCTCCTTT

CTTGCTGAACACTAACTGTATCTTTCATAACATTGCACAACCAGGCCAGAGCTGACTGATGATGTCATTTGTGAAATTCTTGTGCTTGGAGGCCTCTAGT

CATGTGTGCCTTCCATCGTGCCGGAGCTGTGTCCCATGTCTAGTAGAGGCCTCCTCATTCATTACAGTCCTCACAGCCACGTCCTGCCCCCATTCCTGGC

CGGTCTTTACAAAGGTCTATTTCCCCTTGTTCAGGAGGCCCTACTTCCTCTATTGCTATTTTGTCTGCCTATCTCAGAGTTTCTGACTCTTGGCAGGAAG

AACTCAGAAAAATAATTGGTTGGTACTTTATCCTGGCTGTTAGAATAGAATTCTTTCTTTCTTTTGTTGTTGTTCTGTTTTTTGTAGGAAAAACTATAAA

GAATTATAAAATTAAAATTCTAAACCTTTATTTTACTAAGAATAATTTTATTACATCTTTAAATTTTAAGACCAAACAATGTATGTATAATATTGTGCTA

TAAGAAATACATTGGTAGCATATT
Translation
MELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQ LCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVT TDFGLAKQKQESSKLTSMVGTILYSC CP

EVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATK IVEAVYEPVPEGIYSEKVTDTIRR RCLTPDAEARPDIVEVSSMISDVMMKYLDRLS

TSQLALERKLERERRRTQRYFMEANRNAVTCHHELALLSQ ETFEKASLSSSSSGAASLKSELSESAELPGEGCHIPCGKEEDRVCEEVLSEDNFQLESV

EKD DLYSELDDELDVSDNCSSSSSSPLKESTFS SILKRSFSASGRERHSQAR RDFIAGLGSRPRPA ALLPLHLLGKVPHQCPGTT
Transcript ENSMUST00000112630
Sequence
GACTGCCCCAAGGGCAGCTCTGTGCTCTGCCAGCATTCAGTGGATCCTGACACTAAGTTTTCCGTTTTGTGCTCCAACACTCCTTGGAAAGCCCGGGTTC

TAATTTGTGAAGGTTTTCCAGGGCTTTATACTGACTTTACATTTCTGTGACTCCTTTTTGCTTTTGCATAGATGACAGGTTGTATATCGTTATGGAGCTG

ATAGAAGGAGCCCCACTTGGAGAGCACTTTAATTCTTTGAAGGAAAAACATCACCATTTCAGTGAAGAGCGACTGTGGAAAATATTTATACAG CTGTGC

TTAGCTCTTCGGTATCTGCACAAGGAGAAGAGGATTGTTCACAGAGATCTCACGCCAAACAACATTATGCTGGGAGATAAGGACAAAGTGACAGTTA CT

GACTTTGGCCTGGCAAAGCAAAAACAGGAAAGCAGTAAGCTTACATCTATGGTGGGAACGATCCTCTATTCTTG CCCAGAGGTCCTGAAGAGTGAGCCA

TATGGAGAGAAGGCCGATGTCTGGGCTGCTGGCTGCATCCTTTATCAGATGGCGACTCTAAGTCCTCCCTTCTGTAGCACCAACATGCTCTCCTTGGCTA

CTAAA ATAGTGGAGGCTGTATATGAGCCAGTGCCAGAAGGTATCTACTCTGAAAAAGTGACAGATACCATTAGAAG GTGCCTCACTCCTGATGCAGAA

GCCCGTCCAGATATTGTAGAAGTTAGTTCCATGATATCAGATGTCATGATGAAGTATTTAGACAGATTATCCACATCCCAGCTAGCCTTGGAGAGGAAAC

TGGAAAGGGAGCGGAGGCGCACACAGAGATACTTTATGGAAGCCAACAGGAATGCTGTCACATGTCACCATGAGCTGGCTCTTCTGTCCCAG GAGACCT

TTGAGAAGGCAAGCCTGAGCAGCAGTAGCAGCGGGGCAGCCAGCCTGAAAAGTGAGCTTTCAGAGAGCGCAGAGCTGCCTGGAGAGGGCTGCCACATCCC

CTGCGGGAAGGAGGAGGACAGGGTCTGTGAGGAGGTGCTGTCAGAAGACAACTTCCAGCTGGAGAGTGTGGAGAAAG ACCTGTATTCTGAGCTAGACGA

TGAGCTGGACGTCTCGGACAACTGTAGCAGCTCCAGTTCAAGCCCCCTAAAGGAGTCTACATTCA GCATTTTAAAGCGAAGTTTCAGTGCTTCGGGAAG

AGAAAGGCACTCACAGGCAAG GGACTTCATTGCTGGACTAGGATCAAGACCAAGACCAG CTTTGCTGCCCCTCCACCTGCTTGGGAAAGTGCCACACC

AATGCCCAGGGACCACT CATGATCTGAAGAGAAGGGTTATAGAGAGATTCAAGAAGTCCCTGTTCAGTCAGCAGAGCAACCCATGTAACCTGAAATCTG

AAATTAAGAAG - UNI33748 - TTGTCTCAGGGGTCTCCAGAACCCATCGAGCTGAACTTTCTTACCTCAGATTATCATTCACTTCGCCATTCACGA

GCTGCAAACAACTGGTCCCCAAGTGACCCCACAG GTTCACCCAGCAGCTTTGAAGTGGAAGAGGGAGTCACATATGAGCAGATGCAG ACTGTGATTGA

AGAAGTCCTAGAGGAAAGTGGCTATTACAACTTTACAACTAAGAGGTGA
Translation
MELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQ LCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVTVT TDFGLAKQKQESSKLTSMVGTILYSC CP

EVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATK IVEAVYEPVPEGIYSEKVTDTIRR RCLTPDAEARPDIVEVSSMISDVMMKYLDRLS

TSQLALERKLERERRRTQRYFMEANRNAVTCHHELALLSQ ETFEKASLSSSSSGAASLKSELSESAELPGEGCHIPCGKEEDRVCEEVLSEDNFQLESV

EKD DLYSELDDELDVSDNCSSSSSSPLKESTFS SILKRSFSASGRERHSQAR RDFIAGLGSRPRPA ALLPLHLLGKVPHQCPGTT HDLKRRVIER

FKKSLFSQQSNPCNLKSEIKK - UNI33748 - LSQGSPEPIELNFLTSDYHSLRHSRAANNWSPSDPTG GSPSSFEVEEGVTYEQMQ TVIEEVLE

ESGYYNFTTKR
Transcript ENSMUST00000112631
Sequence
TTTACTTCACAAGGAATGCAATGTTAATTCTGAGGTGTTGATGTTTTACAATGCCCGATCAAGATACAAAGGCGAAGAGCACAGAGAAAACCGCTGATAA

GCAACAAGGGACCACCACCAG GGACTATTCAGATCTTAAAAGACTTCGGTGCCTGTTGAACGTTCAGTCAAGCAAACAGCAG CTTCCAGCCATTAACT

TTGACAGTGCCCAAAATAACATGACAAAGTCTGAGCCAACCATCAGGACAGGGGGACATAGAGCTCGTGGTCAATGGCATGAGTCCACAGAAGCAGTTGA

ACTTGAAAATTTTAG TATAAACTATAAGAATGAAAGGAATTTCAGCAAACATCCACAGCATCAGTTATTTCAAGAGATCTTCACAGCTCTGGTGAGAAA

CAGACTTATATGCAG AGAGTGGGTTAATCGTGCTCCATCCATTCATTTTCTGAGAGTGTTAATTTGTCTGAGGCTGCTGATGCGGGATCCATGTTATCA

G GAAATACTCCATAAATTGGGTGGTATTGAAGACCTTGCTCAG TACATGGAGATCGTGGCCAACGAGTACCTGGGCTACGCTGAGGAGCAGCACTGTG

TGGACAAGCTGGTCAATATGACGT ATATTTTTCAAAAACTTGCTGCTGTGAAAGACCAAAGAGAATGGGTTACTGCAAGTGGAGCCCACAAG ACATTA

GTGAGTTTGCTTGGTGCCCGAGACACCACTGTCCTCTTGGGTGCTCTGCTGGCACTGGCCAGCTTAGCAGAGAG TTCAGAGTGTAGGGAGAAGATCAGT

GAACTCAACGTAGTAGAAAATCTGTTGATGATTCTGCACGAATATGATTTACTCTCCAAAAG ACTCACTGCCGAGCTCCTGCGCCTGCTTTGTGCTGAG

CCCCAGATCAAGGAGCAGGTGAAACTCTATGAAGGGATCCCCATCCTGCTCAGTCTGCTTCATTCTGATCACTTGAAGCTGCTGTGGAGTGTGATCTGGA

TTCTGGTCCAGGTGTGTGAGGACCCGGAGACTAGTGTGGAAATCCGAATCTGGGGTGGCATCAAGCAGCTCCTTCATATTTTACAAGG AGACAGAAATT

TTGTTTCTGACCGTTCTTCCATCGGAAGCCTGTCCAGTGCAAATGCCGCAGGACGCATCCAGCAGCTTCATTTGTCAGAAGATTTAAGCCCTGGGGAAAT

CGAGGAAAATACTGTCTCTCTCCAAGCAG CCTGCTGTGCTGCCCTCACCGAGCTGGCCCTCAATGATACCAATGCCCACCAAGTGGTACAG GAAAATG

GTGTATATACAATAGCAAAATTAATTTTACCAAATAAACAATCGAATGCAGCACAAACTAATCTACTACAG TGTTATGCTTTCAGAACCCTGAGGTTTC

TCTTCAGTATGGAAAGGAACAGGCCACTCTTTAAAAG ACTTTTTCCCACCGACCTGTTTGAGACCTTCATTGACATAGGACATTACGTTCGTGATATTG

GTGCTTATAAGGACTTGGTATCACAGTTGAATTTACTATTG GAAGATGAGCTGAAGCAAATTGCTGAGAATATTGAAAGCATCAATCAGAAGAAAGCGC

CCTTGAAGTACATAGGTGACTATGCTGTGTTGGACCACCTTGGAAGTGGAGCTTTTGGCTGTGTTTATAAG GTTAGAAAGCGTAGTGGTCAAAATCTTT

TAGCAATGAAGGAGGTCAATTTGCATAACCCAGCATTTGGAAAGGATAAGAAAGACCGAGACAGCAGTGTCAAGAACATTGTTTCTGAATTAACAATAAT

TAAGGAGCAG CTTTATCATCCCAATGTTGTACGTTATTATAAAACATTTTTGGAAA ATGACAGGTTGTATATCGTTATGGAGCTGATAGAAGGAGCCC

CACTTGGAGAGCACTTTAATTCTTTGAAGGAAAAACATCACCATTTCAGTGAAGAGCGACTGTGGAAAATATTTATACAG CTGTGCTTAGCTCTTCGGT

ATCTGCACAAGGAGAAGAGGATTGTTCACAGAGATCTCACGCCAAACAACATTATGCTGGGAGATAAGGACAAAGTGACAGTTA CTGACTTTGGCCTGG

CAAAGCAAAAACAGGAAAGCAGTAAGCTTACATCTATGGTGGGAACGATCCTCTATTCTTG CCCAGAGGTCCTGAAGAGTGAGCCATATGGAGAGAAGG

CCGATGTCTGGGCTGCTGGCTGCATCCTTTATCAGATGGCGACTCTAAGTCCTCCCTTCTGTAGCACCAACATGCTCTCCTTGGCTACTAAA ATAGTGG

AGGCTGTATATGAGCCAGTGCCAGAAGGTATCTACTCTGAAAAAGTGACAGATACCATTAGAAG GTGCCTCACTCCTGATGCAGAAGCCCGTCCAGATA

TTGTAGAAGTTAGTTCCATGATATCAGATGTCATGATGAAGTATTTAGACAGATTATCCACATCCCAGCTAGCCTTGGAGAGGAAACTGGAAAGGGAGCG

GAGGCGCACACAGAGATACTTTATGGAAGCCAACAGGAATGCTGTCACATGTCACCATGAGCTGGCTCTTCTGTCCCAG GAGACCTTTGAGAAGGCAAG

CCTGAGCAGCAGTAGCAGCGGGGCAGCCAGCCTGAAAAGTGAGCTTTCAGAGAGCGCAGAGCTGCCTGGAGAGGGCTGCCACATCCCCTGCGGGAAGGAG

GAGGACAGGGTCTGTGAGGAGGTGCTGTCAGAAGACAACTTCCAGCTGGAGAGTGTGGAGAAAG ACCTGTATTCTGAGCTAGACGATGAGCTGGACGTC

TCGGACAACTGTAGCAGCTCCAGTTCAAGCCCCCTAAAGGAGTCTACATTCA GCATTTTAAAGCGAAGTTTCAGTGCTTCGGGAAGAGAAAGGCACTCA

CAGGCAAG GGACTTCATTGCTGGACTAGGATCAAGACCAAGACCAG GGCCACAGATGAGCACCTTTGTGGTAGAGTCAG CATCTGCAGGCATCGCTG

TATCCCAGCGGAAAGTGCGGCAGATCTGCGACCCCATTCAGCAGATCCTGATCCAGCTACATAAAGTTATCTACATCACGCAG CTCCCTCCAGCTCTGC

ACCATGATCTGAAGAGAAGGGTTATAGAGAGATTCAAGAAGTCCCTGTTCAGTCAGCAGAGCAACCCATGTAACCTGAAATCTGAAATTAAGAAG - UN

I33748 - TTGTCTCAGGGGTCTCCAGAACCCATCGAGCTGAACTTTCTTACCTCAGATTATCATTCACTTCGCCATTCACGAGCTGCAAACAACTGGT

CCCCAAGTGACCCCACAG GTTCACCCAGCAGCTTTGAAGTGGAAGAGGGAGTCACATATGAGCAGATGCAG ACTGTGATTGAAGAAGTCCTAGAGGAA

AGTGGCTATTACAACTTTACAACTAAGAGGTGA
Translation
MPDQDTKAKSTEKTADKQQGTTTR RDYSDLKRLRCLLNVQSSKQQ LPAINFDSAQNNMTKSEPTIRTGGHRARGQWHESTEAVELENFS SINYKNER

NFSKHPQHQLFQEIFTALVRNRLICR REWVNRAPSIHFLRVLICLRLLMRDPCYQ EILHKLGGIEDLAQ YMEIVANEYLGYAEEQHCVDKLVNMTY 

YIFQKLAAVKDQREWVTASGAHK TLVSLLGARDTTVLLGALLALASLAES SSECREKISELNVVENLLMILHEYDLLSKR RLTAELLRLLCAEPQIK

EQVKLYEGIPILLSLLHSDHLKLLWSVIWILVQVCEDPETSVEIRIWGGIKQLLHILQG GDRNFVSDRSSIGSLSSANAAGRIQQLHLSEDLSPGEIEE

NTVSLQAA ACCAALTELALNDTNAHQVVQ ENGVYTIAKLILPNKQSNAAQTNLLQ CYAFRTLRFLFSMERNRPLFKR RLFPTDLFETFIDIGHYVR

DIGAYKDLVSQLNLLL EDELKQIAENIESINQKKAPLKYIGDYAVLDHLGSGAFGCVYK VRKRSGQNLLAMKEVNLHNPAFGKDKKDRDSSVKNIVSE

LTIIKEQ LYHPNVVRYYKTFLEN NDRLYIVMELIEGAPLGEHFNSLKEKHHHFSEERLWKIFIQ LCLALRYLHKEKRIVHRDLTPNNIMLGDKDKVT

VT TDFGLAKQKQESSKLTSMVGTILYSC CPEVLKSEPYGEKADVWAAGCILYQMATLSPPFCSTNMLSLATK IVEAVYEPVPEGIYSEKVTDTIRR 

RCLTPDAEARPDIVEVSSMISDVMMKYLDRLSTSQLALERKLERERRRTQRYFMEANRNAVTCHHELALLSQ ETFEKASLSSSSSGAASLKSELSESAE

LPGEGCHIPCGKEEDRVCEEVLSEDNFQLESVEKD DLYSELDDELDVSDNCSSSSSSPLKESTFS SILKRSFSASGRERHSQAR RDFIAGLGSRPRP

G GPQMSTFVVESA ASAGIAVSQRKVRQICDPIQQILIQLHKVIYITQ LPPALHHDLKRRVIERFKKSLFSQQSNPCNLKSEIKK - UNI33748 -

 LSQGSPEPIELNFLTSDYHSLRHSRAANNWSPSDPTG GSPSSFEVEEGVTYEQMQ TVIEEVLEESGYYNFTTKR

For any suggestions or comments, please send an email to unitrap@crg.es