Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042569 (Dhrs7b)
Chromosomal location
Chr 11: 60644181 - 60673697 (+)
Description
dehydrogenase/reductase (SDR family) member 7B Gene [Source:MGI (curated);Acc:Dhrs7b-001]
RefSeq_dna
NM_145428 
RefSeq_peptide
NP_663403.1 
UniGene
Mm.21475 
MGI
MGI:2384931 
Uniprot/SWISSPROT
Q99J47 
Human Ortholog
ENSG00000109016 (DHRS7B)
Omim not available
UniTrap UNI1243
Vector Insertion
Chr 11: 60644234 - 60657666
Public Clones (sanger) DD0931 (sanger) E049C12 (ggtc) E126E08 (ggtc) E025A08 (ggtc)
E125F09 (ggtc) E001D06 (ggtc) IST12510G3 (tigm) IST11043F8 (tigm)
IST11023F3 (tigm) IST14919F10 (tigm) IST10077H11 (tigm) IST14613C9 (tigm)
IST14471C2 (tigm) IST14125H1 (tigm) IST14408D12 (tigm) IST14588C6 (tigm)
IST10059D6 (tigm) IST10404F1 (tigm) IST13614B3 (tigm) IST14193C11 (tigm)
IST14385H10 (tigm) IST14988D2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15902
Vector Insertion
Chr 11: 60657666 - 60657846
Public Clones not available
Private Clones OST470512 (lexicon) OST459800 (lexicon) OST443825 (lexicon) OST441481 (lexicon)
OST432241 (lexicon) OST428201 (lexicon) OST427659 (lexicon) OST419930 (lexicon)
OST418749 (lexicon) OST415176 (lexicon) OST412415 (lexicon) OST394801 (lexicon)
OST385838 (lexicon) OST385655 (lexicon) OST378063 (lexicon) OST375700 (lexicon)
OST335940 (lexicon) OST315510 (lexicon) OST311834 (lexicon) OST306572 (lexicon)
OST303328 (lexicon) OST303120 (lexicon) OST296196 (lexicon) OST281749 (lexicon)
OST277423 (lexicon) OST267938 (lexicon) OST266404 (lexicon) OST262889 (lexicon)
OST255410 (lexicon) OST251812 (lexicon) OST250873 (lexicon) OST243542 (lexicon)
OST240844 (lexicon) OST238014 (lexicon) OST223435 (lexicon) OST199982 (lexicon)
OST182084 (lexicon) OST176866 (lexicon) OST168820 (lexicon) OST158699 (lexicon)
OST153776 (lexicon) OST118661 (lexicon) OST111219 (lexicon) OST108478 (lexicon)
OST101014 (lexicon) OST91975 (lexicon) OST65207 (lexicon) OST43273 (lexicon)
OST41293 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6534
Vector Insertion
Chr 11: 60657846 - 60662602
Public Clones CSE042 (baygenomics) CMHD-GT_486F4-3 (cmhd)
Private Clones OST445833 (lexicon) OST213656 (lexicon)
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24510
Vector Insertion
Chr 11: 60662707 - 60665243
Public Clones not available
Private Clones OST217031 (lexicon) OST205401 (lexicon) OST187456 (lexicon)
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28337
Vector Insertion
Chr 11: 60669355 - 60671219
Public Clones not available
Private Clones OST33523 (lexicon)
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108718
Sequence
AATTCCGAGGCGGGAGCATGAAGTTGATTGACCATGATCTCTCCGTCCTTTAG - UNI1243 - - UNI15902 - GAAAGGTATGCTGAAGGAGAG

GGTCATGGACTTGGCCTCCCAGACGACCATCCTGCCCCTGCTGTTTGGCTGCCTGGGGATTTTCAGCCTCTTCAGGCTGCTGCAGAGGATCCGCTCAAAG

GCTTACCTGAGGAATGCTGTGGTGGTAGTCACGGGCGCCACCTCAGGTCTCGGCAGAG - UNI6534 - - UNI15902 - AATGTGCCAAAGTCTT

CCATGCTGCGGGGGCTAAACTGGTCCTCTGTGGACGAAATGTGAAGGCCCTGGAGGAGCTCAGCCGGGAACTTGCTGGTTCTTCTCAG - UNI24510 

- GGACAGACACACCAACCCTTCGTGGTGACCTTTGACCTCGCGGATCCTGGTACTATTGCTGCTGCAGCAGCTGAGATCCTCCAGTGCTTTGGCTATGT

GGACGTTCTCATCAATAATGCTGGGATTAGCTACCGTGGTACCATTAGTGATACCATAGTGGACGTGGACCGGAAGGTGATGGAAATAAACTACTTTGGC

CCTGTTGCTCTAACAAAAG CGCTCCTACCCTCCATGGTGGAAAGGAAGCAAGGCCACATCGTCGCCATCAGCAGCATCCAGGGCAAGATCAGCATTCCT

TTCCGATCGGCAT ATTCAGCCTCCAAGCATGCAACCCAGGCATTCTTTGACTGTCTGCGTGCAGAGATGGAAGAGGCTAACATCAAGGTGACTGTGATA

AGCCCTGGCTACATCCATACCAACCTCTCTGTAAATGCTGTCACTGCCGATGGCTCCAGATATGGAG - UNI28337 - CTCTAGACAAGAACACAGC

CCAGGGCCGAAGCGCTGCAGAGGTGGCCCAGGATGTCTTTGATGCTGTGGGGAAGAAGAAAAAAGATGTTCTCCTGACAGACTTTGTGCCATCCATGGCT

GTCTACATCAGAACTCTGGCTCCCGGGCTCTTCTTCAGAATCATGGCCTCTCGGGCCAGAAAAGAGCGGAAATCCAAGAGCTCCTGATGCTGGTAGGGCT

GCTGGCTTGGGCAGCCTGATCAGACCGACTACCACACCTTCCTGGGTGGGGATTGCAGTGCACGGGATCCGCCGCTAAGACCTGGTGGAGGGCTACCTTG

TATTTGTTTCCCAGGGAGTGATTAGCTCTTAAGGAGTGAAATATGGAGTTGTACAGGAACACTAAACGATGTAAAATAAATGACTGAAGAGTGGGTCAGA

GTTCACAGTAGAAGAACCATGTACAGGTCTTCTGAGTCTCGGACGTCCCTGGTTTCGGAAGTGGTTCTGGAGGTTTGGGGACCAGGCATAATAGCACCAG

CCCCAAATCTGGCTTTTTCTTTTGTTTTTCAAGACAGGGTTTCTCTGTGTTGCCCCAGCTATACTGGAACTCACTCTGTAGACCAAGCTGGCCTTAAACT

CAAGAATCCACTTGCCTCTGTCCCCCAACTCCCAGGGCTGGGATTAAAGTTGTGTACCACCCCCATCCCTATTCATCCTACCTTCTCAAATCTGCTCTTA

GTTTGGCTTATTGGAGGCCACTGGCCCAATTCTTATGGAAGAGGCCTGAGGGAGAAGGCTGGTAGTCTTAAGATGGTCCCAGGTCCTGCTCTTACTGTAG

AAAGTGGGTGAGTGTGGAAGGATGTTTGGTGTATCCTATGTAGTGCCAACTTTAGCAATCAGGAAGAATTCCCCCGAGTCCTCTCCCCTGGTCCTGTTAC

TTTTCCAGTAGCCTCACCGGGTACCATTCCAAGCTGAGGTGAGCCTGTTGGAGAGCAGCCAACAAGGAGAGTTGCTGCTTGGCTCTGGTGTGGCATGGGA

AGAAGGCACTCAGACTGCAGATGTCGGCTGGGGTTGCACTGCTCAGGCGGTGCCCCAATTCCAGGAAGAGCTAGGAAGAGACCTTGTGCTTACCTTTGAC

TTTTGGTTTCTCTGTGTAGCCCTGGCTGTCCTGGAGCTCCCTCTGTAGACCAGCCTGGCCTCAAACTCAAGAGATCTGCCTGCCTCTGCCTCCAGAGTGT

GGGGGATTAAAGGCGTGCGCCACCACCATCAAGCCACCACTATCGCACCACCACCACCGTCTGGCCACCTCTGACTTATGAAAAAGGCATGAGGTGCAGG

TCAACTTCATTTTCCAAGTTTAGAAGGAAATTTTTTCTGTTATAGAAACTAAAAGCTGAAACCATAGGAGGTGCACTGGAGATCTCCCCAGATATGAGTA

AAACTCCCTTATAAAGCTGTCACGTTCACTTAGCTCTGGGCCTGATGAATTGCCTTTAAAATGAACAGATAAACATTGTGCGTTGAGCATTACCTCCTCC

TCCCTGTCTGCCCTTTCTCTCTCCCATCTTAATCTCCTTCCATCCCCATCACTTCTATTTTATTGTCTATGTACCTCATTTTATGTGACTATATGAAACT

TAGGAGCCAAAAATGAGAAAAACATGAGACACTTGCCTTCTGAGATTCGCTTAATTTAAGGTATTATCTCCAGTTGCACTTGTTTTTTCACAAATGTACA

AAACTTTGTTAATTTTAATAACTGAAGAAAGTCAAAGCTGGGTAGTGGTGGCACACGCCTTTAATCCCAGCACTTGGGAGGCAGAGGCAGGCAGATTTCT

GAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTACCCAGAGAAACCCTGTCTCAAAAAACCAAAAAAAGGGAAGGAAGGAAG

GGAGGAAGGAAGGAAGGAAGGAAGGAAGGCAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAAGAGGAAAGGGAAAGGGAAAGGAGTCAGT

CCAGTGAGTGTGCTGTTTTGTTATCCCTATCTCTATTTCCTGTCTGGTGTTGGACACCTAGGCTGGTTGCATAGCTTAGCTATTGTGATTATTGCTGCAG

CGCTCACGGATGAGCAGGTGTCTCAGATGGTCTGACTCGCACCCCTGGGTAGCACAGGTACACAGCAGGTCTCTTTCTATGAGAAACTTCCATACTGATT

TCTGTACAAGTCACACTAGTTTAGATTCTTACACACAGCAGTGTGTAAGAGTTCCCTTTGCCCACATCCAGGCCAGCGTTTGCTGTTTTCTTAATGACTG

ACTTTGTAACTGAAGTGAGATGTCTGACCTGCATTGCTCTGATGCATAATGAGATGAACAGTTTTCATGTTTTGTAGCCATTTGTATTTATTTCATCTGT

TATGGCTCACTTTTTAAAAGTTCGTTGTGTATTCTAGATATTAACCCTCTCAGCTCTGA
Translation
 - UNI1243 - - UNI15902 - MDLASQTTILPLLFGCLGIFSLFRLLQRIRSKAYLRNAVVVVTGATSGLGRE - UNI6534 - - UNI1590

2 - ECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQ - UNI24510 - GQTHQPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGISYRGT

ISDTIVDVDRKVMEINYFGPVALTKA ALLPSMVERKQGHIVAISSIQGKISIPFRSAY YSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSV

NAVTADGSRYGA - UNI28337 - ALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASRARKERKSKSS
Transcript ENSMUST00000042281
Sequence
GGCGGGAGCATGAAGTTGATTGACCATGATCTCTCCGTCCTTTAG - UNI1243 - - UNI15902 - GAAAGGTATGCTGAAGGAGAGGGTCATGG

ACTTGGCCTCCCAGACGACCATCCTGCCCCTGCTGTTTGGCTGCCTGGGGATTTTCAGCCTCTTCAGGCTGCTGCAGAGGATCCGCTCAAAGGCTTACCT

GAGGAATGCTGTGGTGGTAGTCACGGGCGCCACCTCAGGTCTCGGCAGAG - UNI6534 - - UNI15902 - AATGTGCCAAAGTCTTCCATGCTG

CGGGGGCTAAACTGGTCCTCTGTGGACGAAATGTGAAGGCCCTGGAGGAGCTCAGCCGGGAACTTGCTGGTTCTTCTCAG - UNI24510 - GGACAG

ACACACCAACCCTTCGTGGTGACCTTTGACCTCGCGGATCCTGGTACTATTGCTGCTGCAGCAGCTGAGATCCTCCAGTGCTTTGGCTATGTGGACGTTC

TCATCAATAATGCTGGGATTAGCTACCGTGGTACCATTAGTGATACCATAGTGGACGTGGACCGGAAGGTGATGGAAATAAACTACTTTGGCCCTGTTGC

TCTAACAAAAG CGCTCCTACCCTCCATGGTGGAAAGGAAGCAAGGCCACATCGTCGCCATCAGCAGCATCCAGGGCAAGATCAGCATTCCTTTCCGATC

GGCAT ATTCAGCCTCCAAGCATGCAACCCAGGCATTCTTTGACTGTCTGCGTGCAGAGATGGAAGAGGCTAACATCAAGGTGACTGTGATAAGCCCTGG

CTACATCCATACCAACCTCTCTGTAAATGCTGTCACTGCCGATGGCTCCAGATATGGAG - UNI28337 - CTCTAGACAAGAACACAGCCCAGGGCC

GAAGCGCTGCAGAGGTGGCCCAGGATGTCTTTGATGCTGTGGGGAAGAAGAAAAAAGATGTTCTCCTGACAGACTTTGTGCCATCCATGGCTGTCTACAT

CAGAACTCTGGCTCCCGGGCTCTTCTTCAGAATCATGGCCTCTCGGGCCAGAAAAGAGCGGAAATCCAAGAGCTCCTGATGCTGGTAGGGCTGCTGGCTT

GGGCAGCCTGATCAGACCGACTACCACACCTTCCTGGGTGGGGATTGCAGTGCACGGGATCCGCCGCTAAGACCTGGTGGAGGGCTACCTTGTATTTGTT

TCCCAGGGAGTGATTAGCTCTTAAGGAGTGAAATATGGAGTTGTACAGGAACACTAAACGATGTAAAATAAATGACTGAAGAGTGGGTCAGAGTTCACAG

T
Translation
MISPSFR - UNI1243 - - UNI15902 - RKGMLKERVMDLASQTTILPLLFGCLGIFSLFRLLQRIRSKAYLRNAVVVVTGATSGLGRE - UNI

6534 - - UNI15902 - ECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQ - UNI24510 - GQTHQPFVVTFDLADPGTIAAAAAEILQCFG

YVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKA ALLPSMVERKQGHIVAISSIQGKISIPFRSAY YSASKHATQAFFDCLRAEMEEANI

KVTVISPGYIHTNLSVNAVTADGSRYGA - UNI28337 - ALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASR

ARKERKSKSS

For any suggestions or comments, please send an email to unitrap@crg.es