Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042590 (AC165281.2)
Chromosomal location
Chr 13: 107584520 - 107726995 (-)
Description
Importin-11 (Imp11)(Ran-binding protein 11)(RanBP11) [Source:UniProtKB/Swiss-Prot;Acc:Q8K2V6]
RefSeq_dna
NM_029665 
RefSeq_peptide
NP_083941.2 
UniGene
Mm.417493 Mm.132208 
Uniprot/SWISSPROT
Q8K2V6 
Uniprot/SPTREMBL
Q9CY51 Q8BXQ4 
Human Ortholog
ENSG00000086200 (IPO11)
Omim not available
UniTrap UNI8225
Vector Insertion
Chr 13: 107715237 - 107726839
Public Clones (sanger) RRF204 (baygenomics) P024F11 (ggtc) P062C12 (ggtc) E043E01 (ggtc)
PST17540-NR (escells) PST24756-NR (escells) PST21532-NR (escells) IST14999G8 (tigm)
IST14134G7 (tigm) IST10548H1 (tigm) IST10984H11 (tigm) IST14886C12 (tigm)
IST14162E3 (tigm) IST14253E1 (tigm) IST11616D5 (tigm) IST14663E6 (tigm)
IST14547B7 (tigm) IST14114F4 (tigm)
Private Clones OST377664 (lexicon) OST302718 (lexicon) OST299318 (lexicon) OST225823 (lexicon)
OST221714 (lexicon) OST212343 (lexicon) OST164829 (lexicon) OST116307 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7597
Vector Insertion
Chr 13: 107709705 - 107715092
Public Clones RRR432 (baygenomics) (egtc) IST14617B4 (tigm) IST11566D3 (tigm) IST14524C10 (tigm)
Private Clones OST383152 (lexicon) OST224927 (lexicon) OST223635 (lexicon) OST220001 (lexicon)
OST200278 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10828
Vector Insertion
Chr 13: 107700897 - 107709603
Public Clones D031B02 (ggtc)
Private Clones OST442139 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2519
Vector Insertion
Chr 13: 107690898 - 107700279
Public Clones XS0141 (sanger) AJ0365 (sanger) XS0899 (sanger) RRK254 (baygenomics)
RRU483 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4531
Vector Insertion
Chr 13: 107682696 - 107685884
Public Clones AX0027 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8030
Vector Insertion
Chr 13: 107667049 - 107669692
Public Clones RRJ084 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19024
Vector Insertion
Chr 13: 107665688 - 107666318
Public Clones not available
Private Clones OST406827 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8719
Vector Insertion
Chr 13: 107651018 - 107655944
Public Clones XN263 (baygenomics) W028D04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10100
Vector Insertion
Chr 13: 107647606 - 107650940
Public Clones XC245 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19846
Vector Insertion
Chr 13: 107647389 - 107647578
Public Clones (ggtc)
Private Clones OST378913 (lexicon) OST367898 (lexicon)
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18588
Vector Insertion
Chr 13: 107638417 - 107646817
Public Clones 3SE306A12 (ggtc) 5SE306A12 (ggtc)
Private Clones OST420163 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29433
Vector Insertion
Chr 13: 107637540 - 107638320
Public Clones CMHD-GT_413E1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4237
Vector Insertion
Chr 13: 107632291 - 107637425
Public Clones AK0383 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28368
Vector Insertion
Chr 13: 107613132 - 107626291
Public Clones IST14724A5 (tigm)
Private Clones OST32620 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4265
Vector Insertion
Chr 13: 107585876 - 107602287
Public Clones AJ0163 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26614
Vector Insertion
Chr 13: 107585710 - 107585876
Public Clones not available
Private Clones OST107608 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000091253
Sequence
CACATTGGCTGTAGAGGAACCAGTGTGAAGAGTGGCGTTTCCTGCATAGCCATGGCTTTAAAATTCAAAAAACGGTGGAGTGCTGGCGGTCAGCAGTGCC

CAGAGGAACTGAGTTAAAGAACGGAGCTCTGCAGAGTTAAAACAAAGCCTTAAAGCCACGTGATGATACGAGTCCCGTATCCTTG - UNI28368 - T

GTTATCCAAGATAAATTTTGTGGAATTATAAATATCTCAGTGGAGGCTCTTCATGATGTCATGACAGAAGACCCTGAAACAAGAACTTACAAAGA TTGT

ATGTTGATGTCTCAACACGAGGAACCGAAAGTAACAGAAGATGAAGAGCCACCCACAGAACAAGACAAGAGGAAAAAGATG - UNI4265 - - UNI2

6614 - CTGGCCCTGAAGGACCCGGTGCACACAGTGTCTCTGCAGCAGTTCATCTATGAGAAGCTCAAGGCGCAGCAGGAGATCCTGGGGGAGCAAGGC

TTCCAGTCCCTCATGGAAACGGTGGACACAGAGATTGTCACCCAGCTGCAGGAGTTTTTGCAAGGATTCTAA
Translation
MIRVPYPC - UNI28368 - CVIQDKFCGIINISVEALHDVMTEDPETRTYKD DCMLMSQHEEPKVTEDEEPPTEQDKRKKM - UNI4265 - - 

UNI26614 - LALKDPVHTVSLQQFIYEKLKAQQEILGEQGFQSLMETVDTEIVTQLQEFLQGF
Transcript ENSMUST00000109293
Sequence
GCGACGCGGAACATGGCGCGTTCCTAGAAGCCGTTTTCGGCATCAGTAGGCGGCAGCGTGTGGACTAGGAGCGTGGGGGACGAGGAAGCAACCAACGCCG

CTTCGTGTGGACAAGTGGAAAGGGGCGGGCCGGGCGGTTCCGGACCGAAGCACGCG - UNI8225 - ACTTCCATGGATCTCAATAGTGCCAGCTCTG

TGGTTCTTCAGGTCCTAACACAGGCCACCAGTCAGGATACTGCTGTGTTGAAGCCAGCCGAGGAGCAGCTGAAACAGTGGGAGACACAGCCAGGTTTCTA

TTCAGTGTTGCTG - UNI7597 - AATATTTTTACGAATCACACCCTTGATATAAATGTACGGTGGCTTGCTGTGCTGTATTTTAAACATGGGATTGA

TCGTTACTGGAGGCGTGTCGCACCGCA - UNI10828 - TGCTCTCTCAGAAGAGGAAAAGTCAACATTGCGTGCAGGGCTCATCACCAACTTTAATG

AACCAATAAACCAG ATTGCGACCCAGATCGCAGTGCTGATTGCCAAGGTTGCTCGGTTAGACTGTCCTAGGCAGTGGCCGGAGCTCATTCCCACTCTTG

TAGAGTCTGTCAAAGTCCAGGATGACCTTCGCCAGCACAGAGCTCTGCTGACCTTCTACCATGTCACCAAGACGCTGGCATCCAAACGCCTGGCCGCTGA

CAGAAAGCTATTCTATGAT - UNI2519 - TTAGCTTCTGGAATTTATAATTTTGCCTGTTCTCTGTGGAACCATCATACAGACACATTTCTGCAGCA

CGTTTCTTCTGGCAATGAAGCTGCGGTTCTGAGTTCACTAGAGCGAACACTGCTATCGTTAAAAG TGCTGCGGAAGTTAACTGTGAATGGATTTGTGGA

ACCTCATAAGAATATGGAGGTGATG GGTTTTTTACATGGAATATTTGAACGTCTAAAACAGTTTCTGGAGTGCA GCAGAAGTATAGGTACAGATAATG

TGTGTCGAGATAGACTGGAAAAGACCATCATTCTTTTTACTAAAGTG - UNI4531 - CTCTTGGACTTCTTGGATCAACACCCCATTTCATTTACTC

CTCTAATTCAGAGGTCACTGGAATTTTCTGTAAGCTATGTTTTTACTGAAGTTGGTGAAGGCGTTACATTTGAGCGATTCATTGTCCAGTGCATGAATCT

TATTAAGATGATTGTCAAAAATTATGCTTATAAGCCATCCAAAAATTTTGAAG ATAGCAGCCCTGAAACACTTGAAGCCCATAAGATTAAGATGGCATT

CTTCACATATCCCACGTTGACAGAGATATGTCGACGATTAGTCTCTCATTATTTTTTATTAACGGAAGAAGAACTGACCATGTGGGAGGAAGATCCAGAA

GGCTTTA CAGTGGAAGAAACAGGAGGAGACTCTTGGAAATACAGTTTGAGG CCTTGCACTGAAGTATTATTTATAGATATATTCCACGAATATAATCA

AACTCTTACTCCTGTACTTCTAGAAATGATGCAAACTCTTGAAG GTCCAACCAATGTAGAAGATATGAATGCACTGTTAATCAAAGATGCTG TGTATA

ATGCTGTGGGATTAGCTGCTTTTGAGCTGTTTGACAGTGTTGATTTTGATCAGTGGTTTAAAACCCAACTTCTTCCCGAATTACAAGTTTCTCATAATAG

 GTATAAGCCATTACGACGCAGGGTGATTTGGCTCATTGGTCAGTGGATTTCTGTGAAATTCAAGTCTGACTTGAGACCCATGCTGTATGAAGCAATCTG

TAACTTGCTTCAAGATCAGGATTTAGTG - UNI8030 - GTCCGAATTGAAACAGCAACAACTCTGAAGTTAA CTGTTGATGATTTTGAATTTAGGA

CAGATCAGTTTTTACCG - UNI19024 - TATCTGGAAACCATGTTCACACTGCTTTTCCAGTTGCTGCAGCAGGTTACAGAGTGTGATACAAAGATG

CACGTGCTGCACGTCCTCTCCTGTGTGATCGAAAGAGTCAACGTGCAG ATCCGACCATATGTGGGGTGTTTGGTACAGTATTTGCCTCTTCTCTGGAAG

CAGAGCGAAGAACACAACATGCTGCGATGCGCTATTCTGACAACACTTATCCACCTTGTTCAG GGATTAGGAGCAGACAGCAAGAACCTGTACCCTTTC

CTGCTCCCAGTTATCCAGCTGAGTACAGATGTGTCTCAGCCTCCACATGTCTATCTTCTGGAAGATGGCCTGGAGTTATG - UNI8719 - GTTAGTG

ACATTGGAGAACAGCCCATGTGTCACACCAGAGCTGCTTCGTATATTTCAGAACATGTCACCTCTTCTTG - UNI10100 - AGCTTCCATCCAGCTG

CCTTGCAAACG - UNI19846 - AATTAAGTTCAGAGAATCTCAGAACCTGCTTTAAGATCATCAATGGCTATATCTTTTTATCATCAACAGAATTTT

TACAG ACATATGCAGCAGGTTTGTGCCAGTCCTTTTATGAGCTGCTACCAGAGATTACTACAGAAGGTCAAGTTCAAGTGCTGAAG - UNI18588 -

 GTTGTGGAAAATGCCCTTAAAGTGAATCCAGTATTAGGCCCACAGATGTTTCAGCGAATTCTACCCTGTGTTTTCAGAGGTGTTATTGAAGGCGAG - 

UNI29433 - AGGTATCCAGTAGTGATGTCCATTTATCTTGCTGTCATGGGTCGAGTCTTACTCCAGAATACCAGCTTCTTTTCTTCACTTCTTAATGA

GATGGGACACGAGTTTAATCAGGAG - UNI4237 - ATGGACCAGCTTTTAGGAAATGTGATTGAAATGTGGGTCGATCGAATGGACAACATCACACA

GCCCGAAAGAAAGAAACTCTCAGCTTTGGCTTTGCTTTCTCTTCTGCCTTCTGATAATAG - UNI28368 - TGTTATCCAAGATAAATTTTGTGGAA

TTATAAATATCTCAGTGGAGGCTCTTCATGATGTCATGACAGAAGACCCTGAAACAAGAACTTACAAAGA TTGTATGTTGATGTCTCAACACGAGGAAC

CGAAAGTAACAGAAGATGAAGAGCCACCCACAGAACAAGACAAGAGGAAAAAGATG - UNI4265 - - UNI26614 - CTGGCCCTGAAGGACCCG

GTGCACACAGTGTCTCTGCAGCAGTTCATCTATGAGAAGCTCAAGGCGCAGCAGGAGATCCTGGGGGAGCAAGGCTTCCAGTCCCTCATGGAAACGGTGG

ACACAGAGATTGTCACCCAGCTGCAGGAGTTTTTGCAAGGATTCTAAGAGCACGTGTCATGTGGCCACCATCCCTTCTGAAAGAAGCTGAGTAACCCAGC

CTGCCATCCATTTATGAGCCTGCTGAGATAAGATCATTTGTGTATGAATATAAAGAAACCAAGACCATAAATTTTTTACTATAAAATATAAAGAATAAGT

ATAAATCCCAAATATTAAAGTCAGAAAACTATTCCTCAAAAGAATTTAATTTTATATTTATGAGGGGCCCTGTGCTGACTAGAGGTGCATTTATTGAGAG

TAGCTGCATTGTCTCTTGTTAAGAAACTCGCTGATTATCTTTGAATCATGAGCTCTTAACACTTGAGAAGATGAAGGTTGATGTTCCAGATGTTTTTCTG

CAACCCAAAATTAATTAAATGTGGTTGCCTTATCCTAATTTTTTTTAAGCTAATGAAACAAGTTTGAGAAATGAGAATGCTGTGCAAATGATAGAATTCC

ATTTGTGCATAGCAACATCCCAACAGCTGCCCTCTACCTGGGTATCTCACAAGGGAGCTGTTTGCATTCGACAGAGAATCAAATGCTTTTATTTTCATTC

TAGTAGTCTGATAGAGGAATCAGTAAAGGCACTTTTAACTTTACTCTGAGTGCATACATTGCAAGGCACACTGAAGTGAACCTGCAGTACTGTAGTGCCA

AGCGGGAGAGCCCTGGTGAGCCTCCAGCCCTGGCTCCTTTGCTACATGTGAAGGCCAGTAGCCCTGGGAGCACCAGGAAGAACCAGATAACTCCAAGTCC

CCTTCCACTGTGACAGTCGTGCTTGGCTGTGACAGGCTACCCAGTATTTACCCATCTCAGGTTCCTCAGTACCAGGGTGTGTCAGCACCTCAGTGCCATG

GGTGCACCTCAGAGGACCCAGCAGCAGTCCCTGGGTACTAGCACTGACATAACTAGTCTTCCTTCCTGTCCCTCCATTGCACTAAGCGTGCGAGGGAGAG

AACTGACGCCTTACTCTGCATTACTTGCCATTGTGAGGAACCTTTAGTGCATCATCTCCTAGGAAATACTGAAAAGCAAGATTGGAAATGTCGTATCTTT

CTATAGAGATTTGGGTACAGTGTATAACTGTAGGAAAACCACTACCCCTTTGTAAGCTATGGAACCCATAGTGTCTACGGATATATGATGTTTTCAGCAA

AGAAAATATGGTCCAATTAAATTTTCCAAAGATACCTC
Translation
 - UNI8225 - MDLNSASSVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLL - UNI7597 - NIFTNHTLDINVRWLAVLYFKHGIDRYW

RRVAPH - UNI10828 - HALSEEEKSTLRAGLITNFNEPINQ IATQIAVLIAKVARLDCPRQWPELIPTLVESVKVQDDLRQHRALLTFYHVTKTL

ASKRLAADRKLFYD - UNI2519 - LASGIYNFACSLWNHHTDTFLQHVSSGNEAAVLSSLERTLLSLKV VLRKLTVNGFVEPHKNMEVM GFLHGI

FERLKQFLECS SRSIGTDNVCRDRLEKTIILFTKV - UNI4531 - LLDFLDQHPISFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMI

VKNYAYKPSKNFED DSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFT TVEETGGDSWKYSLR PCTEVLFIDIFHEYNQ

TLTPVLLEMMQTLEG GPTNVEDMNALLIKDAV VYNAVGLAAFELFDSVDFDQWFKTQLLPELQVSHNR RYKPLRRRVIWLIGQWISVKFKSDLRPML

YEAICNLLQDQDLV - UNI8030 - VRIETATTLKLT TVDDFEFRTDQFLP - UNI19024 - YLETMFTLLFQLLQQVTECDTKMHVLHVLSCV

IERVNVQ IRPYVGCLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQ GLGADSKNLYPFLLPVIQLSTDVSQPPHVYLLEDGLELW - UNI8719 - W

LVTLENSPCVTPELLRIFQNMSPLLE - UNI10100 - ELPSSCLANE - UNI19846 - ELSSENLRTCFKIINGYIFLSSTEFLQ TYAAGLCQ

SFYELLPEITTEGQVQVLK - UNI18588 - VVENALKVNPVLGPQMFQRILPCVFRGVIEGE - UNI29433 - RYPVVMSIYLAVMGRVLLQNT

SFFSSLLNEMGHEFNQE - UNI4237 - MDQLLGNVIEMWVDRMDNITQPERKKLSALALLSLLPSDNS - UNI28368 - SVIQDKFCGIINISV

EALHDVMTEDPETRTYKD DCMLMSQHEEPKVTEDEEPPTEQDKRKKM - UNI4265 - - UNI26614 - LALKDPVHTVSLQQFIYEKLKAQQEI

LGEQGFQSLMETVDTEIVTQLQEFLQGF
Transcript ENSMUST00000080856
Sequence
GCGACGCGGAACATGGCGCGTTCCTAGAAGCCGTTTTCGGCATCAGTAGGCGGCAGCGTGTGGACTAGGAGCGTGGGGGACGAGGAAGCAACCAACGCCG

CTTCGTGTGGACAAGTGGAAAGGGGCGGGCCGGGCGGTTCCGGACCGAAGCACGCG - UNI8225 - ACTTCCATGGATCTCAATAGTGCCAGCTCTG

TGGTTCTTCAGGTCCTAACACAGGCCACCAGTCAGGATACTGCTGTGTTGAAGCCAGCCGAGGAGCAGCTGAAACAGTGGGAGACACAGCCAGGTTTCTA

TTCAGTGTTGCTG - UNI7597 - AATATTTTTACGAATCACACCCTTGATATAAATGTACGGTGGCTTGCTGTGCTGTATTTTAAACATGGGATTGA

TCGTTACTGGAGGCGTGTCGCACCGCA - UNI10828 - TGCTCTCTCAGAAGAGGAAAAGTCAACATTGCGTGCAGGGCTCATCACCAACTTTAATG

AACCAATAAACCAG ATTGCGACCCAGATCGCAGTGCTGATTGCCAAGGTTGCTCGGTTAGACTGTCCTAGGCAGTGGCCGGAGCTCATTCCCACTCTTG

TAGAGTCTGTCAAAGTCCAGGATGACCTTCGCCAGCACAGAGCTCTGCTGACCTTCTACCATGTCACCAAGACGCTGGCATCCAAACGCCTGGCCGCTGA

CAGAAAGCTATTCTATGAT - UNI2519 - TTAGCTTCTGGAATTTATAATTTTGCCTGTTCTCTGTGGAACCATCATACAGACACATTTCTGCAGCA

CGTTTCTTCTGGCAATGAAGCTGCGGTTCTGAGTTCACTAGAGCGAACACTGCTATCGTTAAAAG TGCTGCGGAAGTTAACTGTGAATGGATTTGTGGA

ACCTCATAAGAATATGGAGGTGATG GGTTTTTTACATGGAATATTTGAACGTCTAAAACAGTTTCTGGAGTGCA GCAGAAGTATAGGTACAGATAATG

TGTGTCGAGATAGACTGGAAAAGACCATCATTCTTTTTACTAAAGTG - UNI4531 - CTCTTGGACTTCTTGGATCAACACCCCATTTCATTTACTC

CTCTAATTCAGAGGTCACTGGAATTTTCTGTAAGCTATGTTTTTACTGAAGTTGGTGAAGGCGTTACATTTGAGCGATTCATTGTCCAGTGCATGAATCT

TATTAAGATGATTGTCAAAAATTATGCTTATAAGCCATCCAAAAATTTTGAAG ATAGCAGCCCTGAAACACTTGAAGCCCATAAGATTAAGATGGCATT

CTTCACATATCCCACGTTGACAGAGATATGTCGACGATTAGTCTCTCATTATTTTTTATTAACGGAAGAAGAACTGACCATGTGGGAGGAAGATCCAGAA

GGCTTTA CAGTGGAAGAAACAGGAGGAGACTCTTGGAAATACAGTTTGAGG CCTTGCACTGAAGTATTATTTATAGATATATTCCACGAATATAATCA

AACTCTTACTCCTGTACTTCTAGAAATGATGCAAACTCTTGAAG GTCCAACCAATGTAGAAGATATGAATGCACTGTTAATCAAAGATGCTG TGTATA

ATGCTGTGGGATTAGCTGCTTTTGAGCTGTTTGACAGTGTTGATTTTGATCAGTGGTTTAAAACCCAACTTCTTCCCGAATTACAAGTTTCTCATAATAG

 GTATAAGCCATTACGACGCAGGGTGATTTGGCTCATTGGTCAGTGGATTTCTGTGAAATTCAAGTCTGACTTGAGACCCATGCTGTATGAAGCAATCTG

TAACTTGCTTCAAGATCAGGATTTAGTG - UNI8030 - GTCCGAATTGAAACAGCAACAACTCTGAAGTTAA CTGTTGATGATTTTGAATTTAGGA

CAGATCAGTTTTTACCG - UNI19024 - TATCTGGAAACCATGTTCACACTGCTTTTCCAGTTGCTGCAGCAGGTTACAGAGTGTGATACAAAGATG

CACGTGCTGCACGTCCTCTCCTGTGTGATCGAAAGAGTCAACGTGCAG ATCCGACCATATGTGGGGTGTTTGGTACAGTATTTGCCTCTTCTCTGGAAG

CAGAGCGAAGAACACAACATGCTGCGATGCGCTATTCTGACAACACTTATCCACCTTGTTCAG GGATTAGGAGCAGACAGCAAGAACCTGTACCCTTTC

CTGCTCCCAGTTATCCAGCTGAGTACAGATGTGTCTCAGCCTCCACATGTCTATCTTCTGGAAGATGGCCTGGAGTTATG - UNI8719 - GTTAGTG

ACATTGGAGAACAGCCCATGTGTCACACCAGAGCTGCTTCGTATATTTCAGAACATGTCACCTCTTCTTG - UNI10100 - - UNI19846 - AAT

TAAGTTCAGAGAATCTCAGAACCTGCTTTAAGATCATCAATGGCTATATCTTTTTATCATCAACAGAATTTTTACAG ACATATGCAGCAGGTTTGTGCC

AGTCCTTTTATGAGCTGCTACCAGAGATTACTACAGAAGGTCAAGTTCAAGTGCTGAAG - UNI18588 - GTTGTGGAAAATGCCCTTAAAGTGAAT

CCAGTATTAGGCCCACAGATGTTTCAGCGAATTCTACCCTGTGTTTTCAGAGGTGTTATTGAAGGCGAG - UNI29433 - AGGTATCCAGTAGTGAT

GTCCATTTATCTTGCTGTCATGGGTCGAGTCTTACTCCAGAATACCAGCTTCTTTTCTTCACTTCTTAATGAGATGGGACACGAGTTTAATCAGGAG - 

UNI4237 - ATGGACCAGCTTTTAGGAAATGTGATTGAAATGTGGGTCGATCGAATGGACAACATCACACAGCCCGAAAGAAAGAAACTCTCAGCTTTG

GCTTTGCTTTCTCTTCTGCCTTCTGATAATAG - UNI28368 - TGTTATCCAAGATAAATTTTGTGGAATTATAAATATCTCAGTGGAGGCTCTTCA

TGATGTCATGACAGAAGACCCTGAAACAAGAACTTACAAAGA TTGTATGTTGATGTCTCAACACGAGGAACCGAAAGTAACAGAAGATGAAGAGCCACC

CACAGAACAAGACAAGAGGAAAAAGATG - UNI4265 - - UNI26614 - CTGGCCCTGAAGGACCCGGTGCACACAGTGTCTCTGCAGCAGTTCA

TCTATGAGAAGCTCAAGGCGCAGCAGGAGATCCTGGGGGAGCAAGGCTTCCAGTCCCTCATGGAAACGGTGGACACAGAGATTGTCACCCAGCTGCAGGA

GTTTTTGCAAGGATTCTAAGAGCACGTGTCATGTGGCCACCATCCCTTCTGAAAGAAGCTGAGTAACCCAGCCTGCCATCCATTTATGAGCCTGCTGAGA

TAAGATCATTTGTGTATGAATATAAAGAAACCAAGACCATAAATTTTTTACTATAAAATATAAAGAATAAGTATAAATCCCAAATATTAAAGTCAGAAAA

CTATTCCTCAAAAGAATTTAATTTTATATTTATGAGGGGCCCTGTGCTGACTAGAGGTGCATTTATTGAGAGTAGCTGCATTGTCTCTTGTTAAGAAACT

CGCTGATTATCTTTGAATCATGAGCTCTTAACACTTGAGAAGATGAAGGTTGATGTTCCAGATGTTTTTCTGCAACCCAAAATTAATTAAATGTGGTTGC

CTTATCCTAATTTTTTTTAAGCTAATGAAACAAGTTTGAGAAATGAGAATGCTGTGCAAATGATAGAATTCCATTTGTGCATAGCAACATCCCAACAGCT

GCCCTCTACCTGGGTATCTCACAAGGGAGCTGTTTGCATTCGACAGAGAATCAAATGCTTTTATTTTCATTCTAGTAGTCTGATAGAGGAATCAGTAAAG

GCACTTTTAACTTTACTCTGAGTGCATACATTGCAAGGCACACTGAAGTGAACCTGCAGTACTGTAGTGCCAAGCGGGAGAGCCCTGGTGAGCCTCCAGC

CCTGGCTCCTTTGCTACATGTGAAGGCCAGTAGCCCTGGGAGCACCAGGAAGAACCAGATAACTCCAAGTCCCCTTCCACTGTGACAGTCGTGCTTGGCT

GTGACAGGCTACCCAGTATTTACCCATCTCAGGTTCCTCAGTACCAGGGTGTGTCAGCACCTCAGTGCCATGGGTGCACCTCAGAGGACCCAGCAGCAGT

CCCTGGGTACTAGCACTGACATAACTAGTCTTCCTTCCTGTCCCTCCATTGCACTAAGCGTGCGAGGGAGAGAACTGACGCCTTACTCTGCATTACTTGC

CATTGTGAGGAACCTTTAGTGCATCATCTCCTAGGAAATACTGAAAAGCAAGATTGGAAATGTCGTATCTTTCTATAGAGATTTGGGTACAGTGTATAAC

TGTAGGAAAACCACTACCCCTTTGTAAGCTATGGAACCCATAGTGTCTACGGATATATGATGTTTTCAGCAAAGAAAATATGGTCCAATTAAATTTTCCA

AAGATACCTC
Translation
 - UNI8225 - MDLNSASSVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLL - UNI7597 - NIFTNHTLDINVRWLAVLYFKHGIDRYW

RRVAPH - UNI10828 - HALSEEEKSTLRAGLITNFNEPINQ IATQIAVLIAKVARLDCPRQWPELIPTLVESVKVQDDLRQHRALLTFYHVTKTL

ASKRLAADRKLFYD - UNI2519 - LASGIYNFACSLWNHHTDTFLQHVSSGNEAAVLSSLERTLLSLKV VLRKLTVNGFVEPHKNMEVM GFLHGI

FERLKQFLECS SRSIGTDNVCRDRLEKTIILFTKV - UNI4531 - LLDFLDQHPISFTPLIQRSLEFSVSYVFTEVGEGVTFERFIVQCMNLIKMI

VKNYAYKPSKNFED DSSPETLEAHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFT TVEETGGDSWKYSLR PCTEVLFIDIFHEYNQ

TLTPVLLEMMQTLEG GPTNVEDMNALLIKDAV VYNAVGLAAFELFDSVDFDQWFKTQLLPELQVSHNR RYKPLRRRVIWLIGQWISVKFKSDLRPML

YEAICNLLQDQDLV - UNI8030 - VRIETATTLKLT TVDDFEFRTDQFLP - UNI19024 - YLETMFTLLFQLLQQVTECDTKMHVLHVLSCV

IERVNVQ IRPYVGCLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQ GLGADSKNLYPFLLPVIQLSTDVSQPPHVYLLEDGLELW - UNI8719 - W

LVTLENSPCVTPELLRIFQNMSPLLE - UNI10100 - - UNI19846 - ELSSENLRTCFKIINGYIFLSSTEFLQ TYAAGLCQSFYELLPEITT

EGQVQVLK - UNI18588 - VVENALKVNPVLGPQMFQRILPCVFRGVIEGE - UNI29433 - RYPVVMSIYLAVMGRVLLQNTSFFSSLLNEMG

HEFNQE - UNI4237 - MDQLLGNVIEMWVDRMDNITQPERKKLSALALLSLLPSDNS - UNI28368 - SVIQDKFCGIINISVEALHDVMTEDP

ETRTYKD DCMLMSQHEEPKVTEDEEPPTEQDKRKKM - UNI4265 - - UNI26614 - LALKDPVHTVSLQQFIYEKLKAQQEILGEQGFQSLME

TVDTEIVTQLQEFLQGF

For any suggestions or comments, please send an email to unitrap@crg.es