Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042644 (Itpr3)
Chromosomal location
Chr 17: 27194481 - 27259167 (+)
Description
inositol 1,4,5-triphosphate receptor 3 Gene [Source:MGI (curated);Acc:Itpr3-001]
RefSeq_dna
NM_080553 
RefSeq_peptide
NP_542120.2 
UniGene
Mm.328900 Mm.458106 
MGI
MGI:96624 
Uniprot/SWISSPROT
P70227 
Uniprot/SPTREMBL
Q0IJ80 Q922U9 
Human Ortholog
ENSG00000096433 (ITPR3)
Omim not available
UniTrap UNI15218
Vector Insertion
Chr 17: 27194620 - 27210042
Public Clones D112A02 (ggtc) D110A02 (ggtc) PST9652-NL (escells) IST10762F10 (tigm)
IST12767D9 (tigm)
Private Clones OST472027 (lexicon) OST465063 (lexicon) OST302293 (lexicon) OST47090 (lexicon)
OST47003 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20735
Vector Insertion
Chr 17: 27210114 - 27220474
Public Clones IST14937D4 (tigm)
Private Clones OST353342 (lexicon) OST252901 (lexicon) OST208790 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24950
Vector Insertion
Chr 17: 27220597 - 27222033
Public Clones not available
Private Clones OST200026 (lexicon) OST194255 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32831
Vector Insertion
Chr 17: 27253243 - 27253553
Public Clones IST14042A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049308
Sequence
AGCTCGCTTCAGGGCGACCTCGTCGCCTCGAGCCCCGGAGGGCCGAAGCCATGAATGAAATGTCCAGCTTTCTTCACATCGGGGACATTGTGTCCCTGTA

CGCCGAGGGCTCTGTCAATGGCTTCATCAGCACTTTGGG - UNI15218 - GCTGGTGGATGACCGTTGTGTGGTGGAACCTGCAGCTGGGGACCTGG

ACAACCCCCCCAAGAAGTTCCGAG - UNI20735 - ATTGCCTCTTCAAAGTGTGCCCCATGAACCGCTACTCTGCACAGAAACAGTACTGGAAAGCC

AAGCAGACTAAACAGGACAAAGAGAAGATTGCTGATGTGGTATTGCTGCAGAAGCTGCAG - UNI24950 - CACGCAGCCCAGATGGAGCAGAAGCA

AAATGACACAGAGAACAAGAAGGTGCACGGGGACGTGGTGAAGTACGGCAGCGTGATTCAG CTTCTGCATATGAAGAGCAACAAATACTTAACTGTGAA

CAAGCGGCTGCCAGCCCTGCTGGAGAAGAATGCCATGCGGGTGACGCTGGATGCTACGGGCAATGAGGGCTCCTGGCTCTTCATCCAGCCCTTCTGGAAG

CTTCGGAGCAATGGGGATAAT GTGGTCGTGGGGGACAAGGTGATCCTGAATCCTGTCAATGCCGGGCAGCCCTTACATGCCAGCAACTATGAGCTTAGT

GATAATGCTGGCTGCAAAGAG GTCAACTCTGTCAACTGCAACACCAGCTGGAAGATCAACTTATTCATGCAGTTCCGGGACCACCTGGAGGAGGTGCTG

AAGGGG GGAGACGTGGTGCGACTGTTCCACGCGGAGCAGGAGAAGTTCCTGACCTGTGATGAGTACAGGGGCAAGCTGCAGGTGTTCCTGCGGACCACG

CTCCGCCAGTCCGCCACCTCGGCCACCAGCTCCAACGCACTCTGGGAGGTGGAG GTGGTCCACCACGACCCCTGCCGCGGGGGAGCCGGACACTGGAAC

GGTCTGTACAGGTTCAAGCACCTGGCCACGGGCAACTATCTGGCCGCTGAG GAAAACCCCAGCTACAAGGGTGATGTCTCAGATCCTAAGGCAGCTGGA

CTG GGGGCCCAGGGCCGCACTGGCCGCAGGAACGCAGGCGAGAAGATCAAGTACCGTCTGGTGGCTGTGCCACATGGGAATGACATCGCGTCTCTCTTC

GAGCTGGACCCCACCACGCTGCAGAAAACCGACTCCTTCGTGCCCCG GAACTCCTACGTGCGGCTGCGGCACCTCTGCACCAACACCTGGATCCAGAGT

ACCAACGCGCCCATCGACGTGGAGGAGGAACGGCCTATCCGGCTCATG TTGGGCACATGCCCCACCAAGGAGGACAAAGAGGCCTTTGCCATTGTGTCG

GTTCCTGTGTCGGAGATCCGCGACCTGGACTTTGCCAACGACGCCAGCTCCATGCTGGCCAGCGCCGTGGAGAAACTCAACGAAGGCTTCATCAGCCAGA

ACGACCGCAG GTTTGTCATCCAGCTGTTGGAGGACTTGGTGTTTTTTGTCAGCGATGTTCCCAACAATGGGCAGAATGTCCTGGACATCATGGTCACCA

AGCCCAACCGGGAGCGGCAGAAGCTGATGCGGGAGCAGAACATACTTAAGCAG ATCTTTGGCATCCTGAAGGCTCCATTCCGTGACAAGGGGGGTGAAG

GACCACTAGTGCGGCTGGAGGAACTGTCTGACCAGAAGAACGCCCCCTACCAGTACATGTTCCGTCTCTGCTACCGGGTGTTGCGGCATTCTCAGGAGGA

CTACCGCAAGAATCAG GAGCACATAGCCAAGCAGTTTGGGATGATGCAGTCACAGATTGGCTATGACATCCTGGCTGAAGACACCATCACTGCCCTGCT

GCACAACAACCGGAAGCTTCTAGAGAAACACATCACCAAGACGGAGGTGGAGACCTTTGTCAGTCTCGTGCGCAAGAACAGGGAGCCCAG ATTCCTGGA

CTACCTCTCCGACCTGTGCGTGTCCAACCGTATCGCCATCCCTGTCACCCAAGAGCTGATTTGCAAATGTGTGCTGGACCCTAAGAACAGTGACATTCTT

ATCCAGACTGA GCTGCGGCCAGTGAAGGAGATGGCTCAGTCTCACGAGTACCTCAGCATCGAGTACTCAGAGGAGGAGGTGTGGCTCACATGGACGGAC

AGGAACAATGAGCACCACGAGAAGAGCGTGAGGCAGCTGGCCCAGGAGGCGAGGGCTGGCAACGCACACGATGAGAACGTGCTCAGCTACTACAG GTAC

CAGTTGAAGCTGTTTGCCCGCATGTGCCTGGACCGCCAGTACTTGGCCATTGATGAGATCTCCAAGCAGCTGGGTGTCGAGCTGCTTTTCCTGTGCATGG

CTGACGAGATGCTGCCCTTTGACCTCCGCGCCTCATTCTGCCATCTGATGCTACATGTGCACGTGGACCGCGACCCTCAGGAGCTGGTGACCCCTGTCAA

GTTTGCCCGCCTCTGGACAGAGATCCCCACGGCCATCACCATTAAAGA CTATGATTCCAATCTCAACGCGTCGAGAGATGACAAAAAAAACAAGTTTGC

CAGCACCATGGAGTTCGTAGAAGATTACCTCAACAACGTGGTCAGCGAGGCCGTGCCCTTTGCCAACGACGAGAAGAACATACTCACCTTTGAG GTGGT

GAGCCTGGCGCACAATCTCATCTACTTCGGGTTCTACAGCTTCAGCGAGCTGCTGAGGCTCACACGCACGCTACTGGGCATCATAGACTGCATCCAGGCA

CCGGCAGCCATGCTGCAGGCCTATGAGGAGCCTGGTG GCAAGAATGTGCGGAGGTCCATCCAGGGGGTGGGGCACATGATGTCCACCATGGTGCTGAGC

CGCAAGCAGTCTGTATTTGGTGCCTCCAGCCTGCCTGCTGGAGTGGGTGTCCCTGAGCAGCTAGACAGAAGCAAATTTGAGGACAATGAGCACACTGTGG

TGATGGAGACCAAACTGAAGATCCTGGAGATTCTGCAG TTCATCCTGAACGTACGCTTAGACTACCGCATCTCCTACCTGTTGTCGGTCTTCAAGAAGG

AGTTTGTGGAGGTGTTTCCCATGCAGGACAGCGGGGCGGACGGCACGGCACCTGCCTTTGATTCCTCCA CTGCCACCATGAATCTGGACCGCATCGGAG

AGCAGGCAGAGGCCATGTTTGGAGTAGG GAAGACCAGCAGCATGCTGGAGGTGGACGATGAAGGTGGCCGCATGTTCCTGCGAGTGCTGCTGCACCTGA

CCATGCACGACTACCCGTCTCTTGTCTCCGGTGCGCTGCAGCTGCTCTTCAAACACTTCAGCCAGCGCCAGGAAGCCATGCACACTTTCAAGCAG GTCC

AGTTGCTGATCTCAGCCCAGGATGTGGAGAACTACAAGGTGATCAAGTCAGAGCTGGACCGACTGCGGACGATGGTGGAGAAGTCAGAGCTGTGGGTGGA

CAAGAAAGGCAGCGTCAAGGGCGAGGAGGTTGAGGCAGGCGCCACCAAGGATAAGAAGGAG AGACCCTCGGACGAGGAGGGATTTCTGCAGCCACACGG

GGAGAAGAGCAGCGAGAACTACCAGATTGTGAAAGGC ATCCTGGAGAGGCTGAACAAGATGTGTGGGGTGGGGGAGCAGATGAGGAAGAAGCAACAAAG

GTTGCTGAAGAACATGGACGCCCACAAGGTCATGCTGGACCTACTGCAGATCCCTTACGACAAG AGCGACAACAAGATGCTGGAGATACTGCGCTACAC

ACACCAGTTCCTACAGAAGTTCTGTGCTGGGAACCCTGGCAACCAGGCCCTTCTGCACAAACACTTGCAGCTCTTCCTCACGCCTGGG CTCCTGGAGGC

TGAGACCATGCAGCACATTTTCCTCAACAACTACCAGCTGTGCTCTGAGATCAGCGAGCCGGTGTTGCAACACTTTGTGCACCTGCTGGCCACACACGGG

CGCCATGTGCAGTACTTGGACTTCCTGCACACTGTCATCAAGGCTGAGGGCAAGTACGTGAAGAAGTGCCAGGACATGATTATGACCGAG CTGACCAAT

GCAGGTGACGACGTGGTGGTGTTCTACAACGACAAGGCCTCTCTGGCTCATCTGTTGGACATGATGAAGGCAGCCAGAGATGGCGTGGAGGACCACAGCC

CTCTCATGTATCACATCTCCCTGGTGGACCTGCTGGCTGCCTGTGCAGAGGGCAAGAACGTCTACACAGAGATCAAGTGCACCTCCCTCTTGCCTCTAGA

GGACGTGGTGACTGTGGTCACCCACGAGGATTGTATCACGGAG GTTAAAATGGCTTATGTGAACTTCGTGAATCACTGCTACGTAGACACGGAGGTGGA

GATGAAGGAGATCTACACCAGCAACCACATCTGGACGCTCTTCGAGAACTTCACCCTGGACATGGCTCTG GTCTGTAACAAGCGGGAGAAGCGCCTGTC

AGACCCCACCCTTGAGAAGTACGTGCTCACCGTGGTCCTGGACACCATCAGTGCCTTCTTCAGCTCCCCGTTTTCAGAGAACAGCACATCCCTACAG AC

GCACCAGACAATTGTGGTCCAGCTGCTGCAGTCCACCACGCGGCTGCTCGAGTGTCCTTGGCTGCAGCAGCAGCATAAGGGCTCCGTGGAGGCCTGTGTC

CGCACCCTCGCCATGGTGG CCAAGAGTAGAGCCATCTTGCTGCCAATGGATCTGGATGCCCACATGAGCGCCCTGCTCAGCAGTGGGGGCAGCTGTTCC

GCCGCTGCCCAGCGCAGCGCTGCCAACTACAAGACGGCCACCAGGACCTTCCCTCGGGTCATCCCCACTGCCAACCAGTGGGACTACAAGAACATCATTG

AGAAGTTACAG GATATCATCATGGCCCTAGAAGAGCGGCTGAAGCCTCTGGTACAGGCTGAGCTCTCTGTCCTTGTGGACATGCTGCACTGGCCTGAGC

TGCTTTTTCCAGAGGGCAGTGAGGCCTACCAGCGCTGCGAGAGCGGGGGCTTCCTGTCTAA GCTCATCCGTCACACTAAGGGTCTCATGGAGTCCGAGG

AGAAGTTGTGCGTGAAGGTGCTGCGGACGCTGCAGCAGATGCTGCTGAAGAAGAGCAAGTTCGGGGACCGG GGCAACCAGCTGCGGAAAATGCTGCTGC

AGAATTATCTCCAGAACCGCAAGTCTGGCGCCCGGGGCGAGCTCACTGACCCCACGGGCTCTG GCCTGGATCAGGACTGGTCAGCCATCGCCGCCACCC

AGTGCCGGCTGGACAAGGAGGGGGCCACCAAGCTGGTGTGTGATCTTATCACCAGCACCAAGAACGAGAAGATCTTCCAGGAGAGCATTGGCCTGGCCAT

CCGCCTGCTGGACGGGGGCAACACCGAGATCCAG AAGTCTTTCTACAACCTGATGACAAGTGACAAGAAGTCGGAGCGCTTCTTCAAGGTGCTTCATGA

CCGCATGAAGCGCGCCCAGCAGGAGACCAAGTCCACGGTCGCTGTCAACATGAGCGACCTGGGCAGCCAGCCTCGTGAGGACCGGGAGCCGGCAGATCCT

GCCACCAAAG GCCGCGTGTCCTCCTTCTCCATGCCCAGCTCCTCCCGCTATTTGCTGGGCCTCGGCTTGCACCGAGGGCACGACATGAGCGAGCGGGCG

CAGAACAACGAGATGGGGACCTCGGTGCTGATCATGCGGCCCATCCTGCGCTTCCTGCAGCTGCTGTGTGAGAACCACAACCGTGACCTGCAA AACTTC

CTGCGCTGTCAGAACAACAAGACCAACTACAACCTGGTGTGTGAGACCCTGCAGTTCCTGGACATCATGTGTGGCAGCACCACAGGGGGCCTGGGGCTGC

TGGGGCTCTACATCAACGAGGACAACGTGGGCCTGGTCATCCAGACCTTGGAGACCCTCACAGAGTACTGCCAGGGCCCATGTCATGAGAACCAG ACCT

GCATTGTGACTCACGAATCCAACGGCATCGACATCATCACGGCGCTGATCCTCAATGACATCAGCCCGCTTTGCAAGTACCGCATGGACCTGGTGCTGCA

GCTCAAG GACAATGCCTCCAAGCTGCTCCTGGCTCTGATGGAGAGCCGACATGACAGTGAGAATGCAGAGCGCATCCTCATCAGCCTTCGGCCTCAGGA

GCTG GTGGACGTGATCAAGAAGGCCTACCTGCAGGAGGAGGAGAGGGAGAATTCAGAAGTGAGCCCACGTGAAGTGGGCCACAACATCTACATCCTAGC

ACTGCAG CTTTCCAGGCACAACAAGCAGCTGCAGCACCTGCTGAAGCCAGTGAGGCGCATCCAGGAGGAGGAGGCCGAGGGCATCTCTTCCATG CTCA

GCCTCAACAATAAGCAGCTGTCCCAGATGCTCAAGTCCTCGGCCCCCGCCCAGGAGGAGGAAGAGGACCCGCTGGCCTACTATGAGAATCACACCTCGCA

GATTGAG ATTGTGCGGCAAGACCGAAGCATGGAGCAGATCGTGTTCCCGGTACCTGCCATCTGCCAGTTCCTGACAGAGGAGACGAAGCACCGGCTCTT

CACCACCACTGAGCAGGACGAGCAGGGCAGCAAAGTGAGCGACTTCTTCGACCAGTCCTCCTTCCTGCACAACGAGATGGAGTGGCAGCGCCGGCTTCGC

A GCATGCCGCTCATCTACTGGTTCTCCCGCCGCATGACGCTGTGGGGCAGCATCTCCTTCAACCTGGCTGTGTTCATCAATATCATCATTGCCTTCTTC

TACCCCTATGTGGAGGGCGCTTCCACAG - UNI32831 - GCGTGCTGGGCTCGCCGCTCATCTCGCTACTCTTCTGGATCCTCATCTGCTTCTCCAT

CGCTGCACTGTTCACCAAGCGCTACAGCGTCCGTCCCCTCATCGTGGCGCTGATCCTTCGGTCCATCTACTACCTGGGCATTGGGCCCACGCTCAACATC

CTGGGTGCTCTCAAT CTGACCAACAAGATCGTGTTTGTGGTGAGCTTCGTGGGCAACCGTGGCACCTTCATCCGAGGCTATAAGGCCATGGTCATGGAC

ATGGAGTTCCTGTACCATGTGGGCTACATCCTGACAAGCGTCCTGGGCCTCTTTGCCCATGAGCTCTTCTACAGCATCCTG CTCTTTGACCTCATCTAC

CGAGAGGAGACGCTGTTTAATGTCATCAAGAGTGTGACCCGCAATGGCCGCTCCATCCTACTGACCGCCCTGCTGGCCCTCATCCTTGTGTACCTCTTCT

CCATCGTGGGCTTCCTCTTCCTCAAGGACGACTTCATCCTGGAGGTGGACCGGCTGCCCGGGAACCACTCCAGAG CCAGCCCCCTGGGGATGCCACACG

GAGCTGCCACATTTATGGGCACATGTAGTGGGGACAAGATGGACTGTGTCTCTGAGGTCTCAGTGCCTGAGATCCTAGAAG AGGACGAGGAGCCCGATA

GCACGGAGCGGGCCTGTGACACTCTACTTATGTGTATCGTGACCGTCATGAACCACGGACTGAGGAACGGTGGTGGCGTGGGCGACATCCTCCGCAAGCC

CTCCAAAGAT GAGTCGCTCTTCCCAGCCAGAGTGGTGTATGACCTTCTGTTCTTCTTTATCGTCATCATCATCGTGTTGAACCTCATCTTTGGGGTGAT

CATCGACACCTTTGCCGATCTGCGCAGCGAGAAGCAGAAGAAAGAGGAAATCCTTAAGACCACGTGCTTCATCTGTG GTCTGGAGAGGGACAAGTTTGA

CAACAAGACAGTGTCCTTCGAGGAGCACATCAAACTGGAGCATAACATGTGGAACTACCTGTACTTCATTGTACTGGTCCGAGTCAAGAACAAGACAGAC

TACACCGGCCCCGAGAGCTATGTGGCTCAGATGATCAAG AACAAGAACCTGGACTGGTTCCCGCGGATGCGTGCCATGTCCCTGGTGAGCGGCGAGGGG

GAGGGGGAGCAGAATGAGATCCGCATCCTGCAGGAGAAGCTCGGCTCCACCATGAAGCTGGTGTCGCACCTCACCTCCCAGCTCAATGAACTCAAGGAGC

AG ATGACGGAGCAGCGGAAACGGAGGCAGCGTCTGGGCTTTGTGGATGTGCAGAACTGCATGAGCCGCTGAGCAGAGCCACCGAGGCCCCCTGCAGGAG

GTCCGCTGCAGATGGCACTGCCCTTCCTTCAGGTCAGGTGGCCCACCACCCTCTGGAAGCCAGGTGCCCACCCCACCTCCAGCTCTGCTGGCAATCTCCC

TCCCCCAAGGCAAACTGGCCAGCAGGAGTGCTTCACAGCAGTCCTGCTTAGTACCGTTGAAGAGACTCAGTTTACCTTAGTGCCTTAGAGGATGCTAGGT

CCTCTGACTGACATTCCTCAGTGGTCCTCACAGGTGGTTATAGGGGGGCTGCCTCTCACCTCCGAGCACTACATTGTGGCTGTCCCCTGCCCGCCTGCCC

GCCTTCTGTCCTGGATCAGGAAGATGGTAGCCTGCTGTTAGTAGCTTCACAGGGCTTTTATGTTTAACTTATTCCCAGGGGCCGTCCCACCCTGCTGTGC

CTGCACAGTTCCCAGTGCCTGTGCCTGCGCCTGCTGGGGACAGTGTGGCCCTGTCCCAGTAGCTTGATGACTCAGGGTGGACCTTGCTCCCAGGACTTGT

CTCTCCCCAGGCTTTGTAGGCAAGCCTCACAAGCCGAGGGACAGGACCGGGCTGTGTGAAAGTGGCTTTTGACAGCTTCTCTCTTTTTGGTGTAATGTTT

TACATGTCCTGTGTCCTGGGGACTAATGTGTTAATTGCCTTAAATAAATTAATAGACTCCAAGTCC
Translation
MNEMSSFLHIGDIVSLYAEGSVNGFISTLG - UNI15218 - GLVDDRCVVEPAAGDLDNPPKKFRD - UNI20735 - DCLFKVCPMNRYSAQKQ

YWKAKQTKQDKEKIADVVLLQKLQ - UNI24950 - HAAQMEQKQNDTENKKVHGDVVKYGSVIQ LLHMKSNKYLTVNKRLPALLEKNAMRVTLDAT

GNEGSWLFIQPFWKLRSNGDN VVVGDKVILNPVNAGQPLHASNYELSDNAGCKE VNSVNCNTSWKINLFMQFRDHLEEVLKG GDVVRLFHAEQEKFL

TCDEYRGKLQVFLRTTLRQSATSATSSNALWEVE VVHHDPCRGGAGHWNGLYRFKHLATGNYLAAE ENPSYKGDVSDPKAAGL GAQGRTGRRNAGEK

IKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPR RNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLM LGTCPTKEDKEAFAIVSVPVSEIRDLDFAN

DASSMLASAVEKLNEGFISQNDRR RFVIQLLEDLVFFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQ IFGILKAPFRDKGGEGPLVRLEELSD

QKNAPYQYMFRLCYRVLRHSQEDYRKNQ EHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFVSLVRKNREPR RFLDYLSDLCVS

NRIAIPVTQELICKCVLDPKNSDILIQTE ELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYR RYQLKLF

ARMCLDRQYLAIDEISKQLGVELLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKD DYDSNLNASRDDKKNKFASTM

EFVEDYLNNVVSEAVPFANDEKNILTFE VVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCIQAPAAMLQAYEEPGG GKNVRRSIQGVGHMMSTMVLSR

KQSVFGASSLPAGVGVPEQLDRSKFEDNEHTVVMETKLKILEILQ FILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSST TATMNLDRI

GEQAEAMFGVG GKTSSMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFKHFSQRQEAMHTFKQ VQLLISAQDVENYKVIKSELDRLRTMVEKSE

LWVDKKGSVKGEEVEAGATKDKKE RPSDEEGFLQPHGEKSSENYQIVKG ILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDK SDNKML

EILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPG LLEAETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMI

MTE LTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITE VKMAYVNFVNH

CYVDTEVEMKEIYTSNHIWTLFENFTLDMAL VCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQ THQTIVVQLLQSTTRLLECPWLQQQ

HKGSVEACVRTLAMVA AKSRAILLPMDLDAHMSALLSSGGSCSAAAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQ DIIMALEERLKPLVQAEL

SVLVDMLHWPELLFPEGSEAYQRCESGGFLSK KLIRHTKGLMESEEKLCVKVLRTLQQMLLKKSKFGDR GNQLRKMLLQNYLQNRKSGARGELTDPTG

SG GLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQ KSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTVAVNM

SDLGSQPREDREPADPATKG GRVSSFSMPSSSRYLLGLGLHRGHDMSERAQNNEMGTSVLIMRPILRFLQLLCENHNRDLQ NFLRCQNNKTNYNLVCE

TLQFLDIMCGSTTGGLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQ TCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLK DNASKLLLALM

ESRHDSENAERILISLRPQEL VDVIKKAYLQEEERENSEVSPREVGHNIYILALQ LSRHNKQLQHLLKPVRRIQEEEAEGISSM LSLNNKQLSQMLK

SSAPAQEEEEDPLAYYENHTSQIE IVRQDRSMEQIVFPVPAICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRS SMPLIYWFS

RRMTLWGSISFNLAVFINIIIAFFYPYVEGASTG - UNI32831 - GVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLN

ILGALN LTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSIL LFDLIYREETLFNVIKSVTRNGRSILLTALLALILVY

LFSIVGFLFLKDDFILEVDRLPGNHSRA ASPLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEE EDEEPDSTERACDTLLMCIVTVMNHGLRNGGGVG

DILRKPSKD ESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICG GLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVL

VRVKNKTDYTGPESYVAQMIK NKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTSQLNELKEQ MTEQRKRRQRLGFVDVQNCMSR

For any suggestions or comments, please send an email to unitrap@crg.es