Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042659 (Arrdc4)
Chromosomal location
Chr 7: 75881880 - 75894124 (-)
Description
arrestin domain containing 4 Gene [Source:MGI (curated);Acc:Arrdc4-001]
RefSeq_dna
NM_001042592 
RefSeq_peptide
NP_079825.2 NP_001036057.1 
UniGene
Mm.251199 Mm.397678 Mm.403375 
MGI
MGI:1913662 
Uniprot/SPTREMBL
Q8VD69 Q9D6S6 Q0GJK1 
Human Ortholog
ENSG00000140450 (ARRDC4)
Omim not available
UniTrap UNI29405
Vector Insertion
Chr 7: 75890098 - 75893654
Public Clones RRJ022 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15994
Vector Insertion
Chr 7: 75887561 - 75889667
Public Clones not available
Private Clones OST468427 (lexicon)
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118110
Sequence
GCGCTGTGGCCGTAGTGGCCCTGGGTGTGCGGCCGGCGCCCGTGACAGCAGCGTCGCGGAGCCGGCTACCCCGACCTGGGGCCACTGCGGATCTTGGTGG

CAGAGCCGCATCGCCTGGCGGAATGGGAGGCGAGGCGGGAGCCGATGGTCCTCGGGGCCGTGTCAAGAGCTTGGGGCTAGTGTTCGAAGATGAGAGCAAG

GGCTGCTACTCAAGCGGCGAGACAGTGGCCGGGCACGTGCTGCTGGAGGCGGCAGAGCCGGTGGCCCTGCGCGGACTGCGCCTGGAGGCCCAGGGCCGTG

CCACCTCTGCCTGGGGCCCGAGCGCTGGGGCCAGGGTCTGCATCGGTGGGGGCTCTCCCGCAGCCTCCTCAGAAGTGGAATACTTGAACCTGCGGTTGAG

TCTGCTGGAGGCCCCAGCTG - UNI29405 - GTGAAGGTGTCACCTTGTTACAACCAGGAAAACACGAGTTTCCCTTTCGCTTTCAGCTTCCGTCTG

A ACCTTTGGCAACATCGTTTACTGGGAAGTATGGCAGTATTCAGTACTGTGTGAGGGCTGTTTTGGAACGACCCCAAGTTCCAGATCAGAGCGTCAGAC

GAGAGCTCCAGGTTGTCAGTCACGTGGATGTCAACACACCGCCCTTATTG - UNI15994 - ACTCCTATGCTGAAGACGCAGGAGAAAATGGTTGGC

TGTTGGCTTTTCACCTCTGGTCCTGTGTCACTGAGCGTCAAGATCGAGAGAAAGGGCTACTGTAACG GAGAAGCTATCCCTATCTATGCAGAAATAGAA

AATTGTTCATCTCGGCTGGTTGTTCCCAAGGCAGCCATATTCCAAACCCAGACGTACTTGGCTAGTGGAAAGACAAAGACAGTCCGGCACATGGTTGCCA

ATGTTCGAGGAAACCACATTGGTTCTGGGAGTACGGACACCTGGAATGGGAAGATGCTGAAGATCCCACCTGTCACCCCATCCATCCTGGATTGCTGCAT

CATCAGAGTGGACTACTCCTTAGCTGTAATCCAAGCTTCTTGAATCATTAAAAATACATAAAACAGA
Translation
MGGEAGADGPRGRVKSLGLVFEDESKGCYSSGETVAGHVLLEAAEPVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASSEVEYLNLRLSLLEAPAG

 - UNI29405 - GEGVTLLQPGKHEFPFRFQLPSE EPLATSFTGKYGSIQYCVRAVLERPQVPDQSVRRELQVVSHVDVNTPPLL - UNI15994 

- TPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNG GEAIPIYAEIENCSSRLVVPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGK

MLKIPPVTPSILDCCIIRVDYSLAVIQAS
Transcript ENSMUST00000048068
Sequence
GGGGTGTGTTAAAGAGACAGGGCCCCAGTGCGGGTGTTTCACCCGGCTGGGCGCTGTGGCCGTAGTGGCCCTGGGTGTGCGGCCGGCGCCCGTGACAGCA

GCGTCGCGGAGCCGGCTACCCCGACCTGGGGCCACTGCGGATCTTGGTGGCAGAGCCGCATCGCCTGGCGGAATGGGAGGCGAGGCGGGAGCCGATGGTC

CTCGGGGCCGTGTCAAGAGCTTGGGGCTAGTGTTCGAAGATGAGAGCAAGGGCTGCTACTCAAGCGGCGAGACAGTGGCCGGGCACGTGCTGCTGGAGGC

GGCAGAGCCGGTGGCCCTGCGCGGACTGCGCCTGGAGGCCCAGGGCCGTGCCACCTCTGCCTGGGGCCCGAGCGCTGGGGCCAGGGTCTGCATCGGTGGG

GGCTCTCCCGCAGCCTCCTCAGAAGTGGAATACTTGAACCTGCGGTTGAGTCTGCTGGAGGCCCCAGCTG - UNI29405 - GTGAAGGTGTCACCTT

GTTACAACCAGGAAAACACGAGTTTCCCTTTCGCTTTCAGCTTCCGTCTGA ACCTTTGGCAACATCGTTTACTGGGAAGTATGGCAGTATTCAGTACTG

TGTGAGGGCTGTTTTGGAACGACCCCAAGTTCCAGATCAGAGCGTCAGACGAGAGCTCCAGGTTGTCAGTCACGTGGATGTCAACACACCGCCCTTATTG

 - UNI15994 - ACTCCTATGCTGAAGACGCAGGAGAAAATGGTTGGCTGTTGGCTTTTCACCTCTGGTCCTGTGTCACTGAGCGTCAAGATCGAGAG

AAAGGGCTACTGTAACG GAGAAGCTATCCCTATCTATGCAGAAATAGAAAATTGTTCATCTCGGCTGGTTGTTCCCAAGGCAGCCATATTCCAAACCCA

GACGTACTTGGCTAGTGGAAAGACAAAGACAGTCCGGCACATGGTTGCCAATGTTCGAGGAAACCACATTGGTTCTGGGAGTACGGACACCTGGAATGGG

AAGATGCTGAAGATCCCACCTGTCACCCCATCCATCCTGGATTGCTGCATCATCAGAGTGGACTACTCCTTAGCT GTATACATTCATATCCCTGGTGCT

AAAAGATTGATGCTGGAGCTGCCTTTGGTTATTGGTACAATTCCATACAGTGGCTTTGGCCGCAGAAACAGCAGTGTCGCAAGCCAGTTCAGTATGGACA

TGTGCTGGTTGGCACTGGCCCTACCGGAGCAGCCTGAAG CACCACCAAATTATGCAGATGTGGTATCGGAAGAAGAATTCTCCCGACACGTTCCTCCGT

ACCCTCAGCCCTCTGACTGTGACGGGGAAGCCTGCTACTCAATGTTTGCCTGCATACAAGAATTCCGTTTCCAGCCTCCCCCCCTTTATTCAGAG GTTG

ATCCACATCCTGGTGATGCCCAAGAGACCCAGCCTGTATCCTTCATTCTCTGAACAGACTCCAGACTTCACTGTGTTGTTACCAACTTAGAATATCGGTT

CTTTCGCCTGCCTTGTTGGATGAAAGAGAAAGTTAACTTCAGAACATCGGTGAACTTCAAGTCCGAAGATGAGAGAAATGAAAGAAGATGAGAACGTTTA

GTGGGCCAGGGGAATGGTTACACGGATTCTAGGGTGGGCTCCCTTGCACGCTTTAAAAGTGGATGAAAATAGGAATTGGAAAACGGGAAGTCCTGGTGGT

GAGAGAGGAAGTGAAAGAGTGCCCAGACTGTTGAGCAGAGGCGTCTTAGGACCTGGGATGTTACTGAATGTTACTGGAGTGTGCTTTGACCAGGGCTCAC

ACACAGTTGTGAACTTATGGACTTGGTAGGAAGACATGATTTGGGGAACAAGACAGCTTTGAAATGAGTGAGAATGAGCGAGTGGTCTACTTTCAATGCA

GTTGAACTCCCCAGACCTTGGGGTCTTCATGATTTCTTATCATGTTACCATAGCAAGGATCCAGGTCCTTGCTGGAGTCAGTGGTCATGTGACATCCTGA

TGGAACTGACAGTGGCTCCAGGCTTTCGTGAGGAAGCTAGAAGGGATTCCTTAACAGCTTGCCATATCAAAAGGAAAAGAGGAACTGTTCATGAAAGTGT

GTGTTGTGAAGGGCTGTACTTACACTTTTAAGAACTGCTTGCAGGGTCTATGTTTGATTTTCCTCGTCCCTTATTTACCTAGGGAATATTAGAAAAAGGA

GGAGTAGGCGGGACATCTTTGGGATACCTGATACTGACACAGAACAGAGTGTTCTCTTATCCTACCTCTAGTGGCTTTGTCAGACCTGCTCTCAAAAGTC

CAGGCCTGGCTGACCTCTGGGGTTTCTGCTCTATGCAGTTAGCAGACTCCTCTCAACCTGTCACTTGACCTGAAAACTAGACCAAGGGAAATGTCCACGA

GCTCAGCATTAAATAGAAATAAATATAAACACCTAAGATCTTAAGAAATCCCAAATCAAAAGAGGACAGGAGCGTGCCTAAACTTGGTTCCTGTGAAGAG

GCCCCAGTGGGTGGGTGACAGTTTCCGTGTAGTGCATTTGTGTTCCAGTACATTAGTAATTACATTGATACTGTGATTTTTTTTAATTGTTTTGGTGCAA

TATTTTGTTGTCTTTGAGCCTCAGGATATTAAGACCTAAGGACTGTGTTGTTGCTGGCAGAGTCAGCCATGTCTCTACCAGCCTCCTCCCTCTGTTCACA

GTCACATGCTCAGCCTCCAGTCTGTTGCTCCCATGAACTGAGAAAATTTTCTGACACCAGGTGGGAGGGAGCCTCTCACAGTTAAGAGCTGGACAAGCCA

AATTCTAAGGGTTTGATTTAGAAACCCTGGTGCTTCCCAGGCAGAGTGTTGTGCCACACCCATCGTGGAGATGGACTTACCTTTCAGTCACCATGTTTCC

TTAGAGACATTCTCCTAGTGTGAAATTTTATATCAAAAGTCAGTGGAGCATTCGTTCAGGGATTTTTGTACCAATGTCCAGTAAATGTGTACTTCTCCCC

GCTGAGCATACCTCTCCTGTGGTCATCCTAGCGTCAGTCACATGTATGTCACTGTATGCCATTTTCAAAAATGCCAAATGGTATTGCCAGTAACTGTGGT

GTGTGAGAATCACCACGGAACCCTATTTCTTGTTTTGGTTTTTTAGAGATTTCTTTCTTTTCTTTTCTGTTATGTGTCTGTAAACAGTTAGGATTGTTCA

CATTCCATCTAAACTGCTTTTATTTTTGCCATGGAAAAGATGGTGAGCTGTCCTTTTTTTAGCTTCCAGCCTGTAGTTTACGTGCTATGTCAAGTCATGG

TCCATCCATAAAACCAAAATGGAGGGAAAGAAAGCAACAGTACGGAGTGGACAGAGAGAAAATGGAGCGCCGTGGCTCACTGTAGATAAGCCCTGGCAGT

CGGGTTGGTTAGAGAAATCATGAAGTCCCCCACAGAACGGAAGCACAGCTAACAGTGGCATTGAAGAGTGCAAAGATATAACTTTATACCTGTCTGTCTG

GCCTGAAGCTTATACCCAGGATAACAGGAATGTAGAAAACTACATCTGAAACCCTGTGACTGAAGATCAGACTTTTAGCTGCTAACACTTGCCTGTCTAG

TCCCCTCTTGCTCTCATTTAGTTTGGGAAAAACGAAAAGTGCCCTTAGGATTTTCTTTTGGATGCACAAAGCTTGCGATTCAAAGTGAGCATCTTTTGGT

GCACACAGACCCTTCCCTTCCCCTGGAGCACAACTTTACTTTCTGTGTCTCTGTTTTGCACAATAAGAAACTCAGTAGGCAAAGGTTGTGTTTTTTTTTT

TGGTAAGTTCACTTGCTTTTTAAAATTTTTATTAAAAATGTAATAATTTAACCAAGGGGAAAATAAAGATTGTATTTTGTATTCTTCTTTGAACCCCATG

GGTTCCTTTTTGTTAATAAAATGGTTATACTAATGA
Translation
MGGEAGADGPRGRVKSLGLVFEDESKGCYSSGETVAGHVLLEAAEPVALRGLRLEAQGRATSAWGPSAGARVCIGGGSPAASSEVEYLNLRLSLLEAPAG

 - UNI29405 - GEGVTLLQPGKHEFPFRFQLPSE EPLATSFTGKYGSIQYCVRAVLERPQVPDQSVRRELQVVSHVDVNTPPLL - UNI15994 

- TPMLKTQEKMVGCWLFTSGPVSLSVKIERKGYCNG GEAIPIYAEIENCSSRLVVPKAAIFQTQTYLASGKTKTVRHMVANVRGNHIGSGSTDTWNGK

MLKIPPVTPSILDCCIIRVDYSLA VYIHIPGAKRLMLELPLVIGTIPYSGFGRRNSSVASQFSMDMCWLALALPEQPEA APPNYADVVSEEEFSRHVP

PYPQPSDCDGEACYSMFACIQEFRFQPPPLYSE VDPHPGDAQETQPVSFIL

For any suggestions or comments, please send an email to unitrap@crg.es