Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042688 (Mapk6)
Chromosomal location
Chr 9: 75234712 - 75257805 (-)
Description
mitogen-activated protein kinase 6 Gene [Source:MGI Symbol;Acc:MGI:1354946]
RefSeq_peptide
NP_056621.4 NP_081694.1 
UniGene
Mm.18856 Mm.410702 Mm.467951 
MGI
MGI:1354946 
Uniprot/SWISSPROT
Q61532 
Uniprot/SPTREMBL
Q8R3S3 
Human Ortholog
ENSG00000069956 (MAPK6)
Omim not available
UniTrap UNI10483
Vector Insertion
Chr 9: 75246559 - 75257669
Public Clones (sanger) M124A11 (ggtc) D134E06 (ggtc) D050E09 (ggtc) 3SE057D03 (ggtc)
A006F10 (ggtc) P028B01 (ggtc) IST14406F2 (tigm)
Private Clones OST456526 (lexicon) OST455101 (lexicon) OST402774 (lexicon) OST391635 (lexicon)
OST388651 (lexicon) OST378316 (lexicon) OST338097 (lexicon) OST330154 (lexicon)
OST324415 (lexicon) OST324313 (lexicon) OST310492 (lexicon) OST222933 (lexicon)
OST199136 (lexicon) OST176461 (lexicon) OST148040 (lexicon) OST139198 (lexicon)
OST132443 (lexicon) OST112336 (lexicon) OST108254 (lexicon) OST103225 (lexicon)
OST90956 (lexicon) OST81234 (lexicon) OST68120 (lexicon) OST66661 (lexicon)
OST61755 (lexicon) OST58716 (lexicon) OST58597 (lexicon) OST58260 (lexicon)
OST58246 (lexicon) OST54006 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049355
Sequence
TCGGGGTTACATGGCGGCGACTGCGGCAAAGCGAGAGCCTCGGAAACGCCGCTGCCGCCAGCACAGCCGGAGACCTGAGCCGACCTTGAGGGCTGTCCGC

GGGCCCTGCACTCTGTCGATGAGTCGGAGAAGTCCC - UNI10483 - GTTGTATCAGAGTAAGATGGACGGTAGCTTTGACTGTGATTGTGGTGAGC

TGGAGCCACCTGATCACTAAGAAGAGACGTCCATCAGCCAACGTCACCAGGGCTTCCTGTTGAAACACAGCGACAAGGAAGCGAGGAAGCAGAGGGAACT

AGTGCTTCCCAGCGCCTTAGGATGCTGCTCAGGACCAGTCCAACACTGAATGTATCTGCACTGTGAGAGGATGTCCACGGAGGCCTGCCGGGCGCATATT

TATTCACAGTTTTGTCCCATGTTAAGTCGGTTAGCATAGTAAATCTGAGTGCATACTATGTCATTTCATTCCGTTTGAGTTTCTTGAGTGTTTTCTTTAA

ATGTCTGCAGAGTTGCTGCCCTTCCTTGAACTATGAGCACTGCAATCTTCTTAATTCTCAGTATGAATAGAGATTTTTGAGCTTTAAGTCTGAGGGGAAC

TCAGCGGGCCTGGTTGGCGTCTGCAATGAACATCAAGAAACCATCGTGCCGTGGGAACGTGATTGCTTTTCTCCCGTTTTGAGAGATCTTTCCTTTGATG

CCAGTTTTCTCCCTTGTTTACACAAGTTCAACAGTTTGAAAGGAAAAGGCAATTGTAAGGGTTTCAAAATGGCAGAGAAATTCGAAAGTCTCATGAACAT

TCATGGCTTTGATCTGGGCTCTAGGTACATGGACTTAAAACCATTGGGCTGCGGAGGCAATGGCTTGGTCTTTTCTGCTGTAGACAATGACTGTGACAAA

AGAGTAGCCATCAAGAAAATTGTCCTCACCGATCCCCAGAGTGTCAAACATGCTCTCCGTGAAATCAAAATTATTCGAAGACTTGACCACGATAACATTG

TGAAAGTGTTTGAAATTCTTGGTCCCAGTGGAAGCCAGTTAACAGACGATGTGGGCTCTCTCACGGAGCTGAATAGCGTCTACATTGTTCAGGAGTATAT

GGAGACAGACTTGGCGAATGTGCTGGAGCAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGTATCAGCTGCTACGTGGGCTCAAATATATCCAT

TCTGCAAACGTACTGCACAGAGATCTCAAGCCAGCTAATCTTTTCATTAACACTGAAGACTTGGTGCTGAAGATAGGTGACTTTGGCCTGGCACGGATCA

TGGATCCTCATTATTCCCATAAG GGTCATCTTTCTGAAGGATTGGTTACCAAATGGTACAGATCTCCACGGCTTTTACTTTCTCCTAATAATTACACTA

AAGCCATTGACATGTGGGCTGCAGGCTGCATCTTTGCTGAGATGCTGACTGGTAAAACCCTCTTTGCAG GTGCACATGAACTTGAACAGATGCAGCTGA

TCCTCGACTCCATCCCTGTTGTGCACGAGGAGGATCGGCAGGAGCTTCTCAGCGTGATTCCAGTTTACATTAGAAACGACATGACTGAGCCACACAGACC

GCTCACTCAGCTGCTGCCGGGGATCAGCCGAGAAG CACTGGATTTCCTGGAGCAGATTCTGACTTTCAGCCCCATGGACCGGCTGACAGCTGAGGAAGC

CCTTTCCCATCCTTACATGAGCATCTACTCCTTCCCGACGGATGAGCCCATCTCAAGCCACCCTTTCCACATAGAGGACGAAGTGGACGACATTTTGCTT

ATGGATGAAACACACAGTCACATTTATAACTGGGAAAG GTACCACGATTGTCAGTTCTCGGAGCATGACTGGCCTATTCATAACAACTTTGATATCGAT

GAGGTGCAGCTTGACCCAAGAGCTCTGTCTGACGTCACCGATGAAGAAGAAGTCCAAGTTGATCCTCGAAAATACTTGGATGGAGACCGAGAGAAGTATC

TAGAGGATCCCGCCTTCGACACCAGCTACTCTGCTGAACCCTGCTGGCAGTACCCAGATCACCACGAGAACAAGTACTGCGATCTGGAGTGTAGCCACAC

CTGTAACTACAAAACAAGATCATCACCATACTTAGATAACCTGGTGTGGAGGGAGAGCGAGGTTAACCATTACTATGAGCCCAAGCTTATTATAGATCTT

TCCAACTGGAAAGAGCAAAGTAAAGAAAAATCCGATAAGAGAGGCAAGTCCAAGTGTGAGAGGAACGGGTTGGTCAAGGCGCAGATCGCGCTAGAGGAAG

CATCCCAGCAGCTGGCTGAGAGGGAGAGGGGCCAAGGCTTCGACTTTGACTCCTTCATCGCGGGGACCATTCAGCTCAGTGCCCAGCATCAGTCTGCTGA

CGTAGTTGACAAGTTAAACGACTTGAATAGCTCAGTGTCCCAGCTAGAATTGAAAAGCCTGATATCCAAGTCAGTCAGCCGAGAAAAGCAAGAAAAGGGA

AGGGCTAACCTGGCCCAGCTGGGAGCCTTGTACCAGTCCTCCTGGGACAGCCAGTTTGTGAGTGGCGGGGAGGAGTGCTTCCTCATCAGTCAGTTTTGTT

GTGAGGTCAGGAAGGACGAGCATGCGGAGAAGGAGAACACCTACACCAGCTATTTGGACAAGTTTTTTAGCAGGAAGGAGGATTCCGAAATGCTAGAAAC

TGAGCCAGTGGAGGAAGGGAAGCGTGGGGAGAGAGGCCGTGAGGCAGGGCTTCTGAGCGGCGGTGGGGAGTTCCTCCTGAGCAAGCAGCTGGAGTCCATA

GGCACCCCGCAGTTCCACAGCCCAGTGGGGTCCCCACTCAAGTCCATCCAGGCCACCTTGACACCTTCCGCTATGAAATCTTCCCCTCAAATCCCTCACA

AGACATACAGCAGCATTCTGAAACATCTGAACTAAACCTCAGCAGACATTTCTCTTTGTTCTTCATGAAATGCGTTGTGTCTTTTTTTATCACTAATGTT

TTAAGTCTTTTTTTTTTTACTTGAATCAGAAGGTGTCATTAATTTGCAAGGATTTTTCTTGGTTCTCAGTTTGTAAAACAGACTTTTTTTTCTACATGTG

AGTTAGTTTTCATTTGAACTGGCATGTCGTTTGCACACACACACATACATACACACACGCACACACACGCAAAGAATAGAGCAAAACAATGCAGTGCAGG

AGGAGACAAGATGCGCTAGGATGATTAGACATTCTCATAGACCAGTGACCTGCTTTACGGGAAACAAAACCTTGCCTTGAAACTTACACAGTGAGACTGT

ACATAATTGCATGAAAAGATCTATTTTTTTCCTGAAACATTTTTCATTCATTAGTATTTTCAAGTTTTTCATACTGTACACATTTCTTAAGACACATGAT

ACCAGCAGCAACTGAAAACGAATGCCGAATTTGGTACACATGTGTTATCTACCTCAAGGTAACAAAAGTATGTGGCGAAGCCTAACCCACCCATAGTGCT

CCACGGCATATGCACTTCTATCTAGCCAGCGTTTATCGTAGTGAACTATTGAGACTCGTCCACCATTTATACATGTCCTGGTGTTCATTCTTTATAGTGA

AGTGTTAAATACATCACATCTTATTTATTTTTAGCAAATCAGTATATTTTCTGTATTTAATTATAAAAGTTAACTTAGTTTTAAGTTTATTTGCAACTGC

CCTTCTTTCCATTTGGCACTATGGTTTGTTGCCTGCCGAGCTGATCCGAGACGTCAGCTCGTCCTGAGGCTGTCCATGTACGTTAAGTAAAGTGCTCACT

GTGTATAGGAATCTGTATTTTGGAGGTGCTTGATCTATCTACAAAGAAAAAATTAGGAATTTATTATAAAATGCTCCTAGAAGTCTTAATGGTGTTTATT

TTTTAAAAACTTGTAATGTTAGACTTGTGTGCATGGAAGTAATTAAGGTACATCACTATTGTAGTTTAAACATTGTACATGATAAGCCTTCCCCCTCCCC

ACCCCCTGTTTTTACTGTATGTTTTTATTGAATGATCTATTCCCCATCCCTAGGCAAGCATGAATAAAATTAGGTTAAATGT
Translation
 - UNI10483 - MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGP

SGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYSHK 

GHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAG GAHELEQMQLILDSIPVVHEEDRQELLSVIPVYIRNDMTEPHRPLTQLLP

GISREA ALDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDETHSHIYNWER RYHDCQFSEHDWPIHNNFDIDEVQ

LDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYSAEPCWQYPDHHENKYCDLECSHTCNYKTRSSPYLDNLVWRESEVNHYYEPKLIIDLSNW

KEQSKEKSDKRGKSKCERNGLVKAQIALEEASQQLAERERGQGFDFDSFIAGTIQLSAQHQSADVVDKLNDLNSSVSQLELKSLISKSVSREKQEKGRAN

LAQLGALYQSSWDSQFVSGGEECFLISQFCCEVRKDEHAEKENTYTSYLDKFFSRKEDSEMLETEPVEEGKRGERGREAGLLSGGGEFLLSKQLESIGTP

QFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHLN

For any suggestions or comments, please send an email to unitrap@crg.es