Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042757 (Tmem108)
Chromosomal location
Chr 9: 103386108 - 103664132 (-)
Description
transmembrane protein 108 Gene [Source:MGI Symbol;Acc:MGI:1932411]
RefSeq_dna
NM_178638 
RefSeq_peptide
NP_848753.1 
MGI
MGI:1932411 
Uniprot/SWISSPROT
Q8BHE4 
Human Ortholog
ENSG00000144868 (TMEM108)
Omim not available
UniTrap UNI13591
Vector Insertion
Chr 9: 103655298 - 103664084
Public Clones CMHD-GT_287F10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36359
Vector Insertion
Chr 9: 103512040 - 103655298
Public Clones IST10844D6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31336
Vector Insertion
Chr 9: 103401131 - 103512127
Public Clones PST19319-NR (escells) IST10253B3 (tigm) IST14292H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26507
Vector Insertion
Chr 9: 103391674 - 103401131
Public Clones not available
Private Clones OST113906 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28402
Vector Insertion
Chr 9: 103387114 - 103391518
Public Clones not available
Private Clones OST31931 (lexicon)
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049452
Sequence
GGGGCTTTCTCCGGAGCCGTCGGAGGGAGCCGGAGCGCTTCTCCCGAG - UNI13591 - - UNI36359 - ATCGCTTTGCTGTGGTCCAGCATGC

AGAAGTAAGCGTGTGGTGAAAGGCAGCAGATCCGATGGGTTGCGAGGATGTAAGATCGTCTGAAGGCTTCCACACCCTCTCCTCCAGG - UNI31336 

- - UNI36359 - ACAGAATCATGAATAAACTGGAGGACCAGCAGGACCAGATGATACCATGAAGAGAAGTTTACAGGCCCTCTATTGCCAACTATTA

A - UNI31336 - - UNI36359 - GCTTTCTCCTGACCTTGGCACTGACCAAAGCACTGGTACTCGCTGTCCACGAACCATCTCCCAGGGAATCTC

TACAGACCCTCCCCTCAGGCAGCCCCCCAGGCACCATGGTGACAGCACCTCACAGCCCTACCAGACTCTCCTCTGTGCTGACACTGAATCCTACACCTGA

TGGACCCTCATCACAGGCTGCAGCTACTCTGGAAACTACAGTATCTCATCCAGAAGGGCACCCTCCTACAGACACCACGTCTACAGTGATGGGGACAGCT

GCCGTCCCGCATCCCGAAAGTCCTCTGCCCACAGGGTCCCCTCCAGCTGCCATGACAACCACACCCTCCCACTCAGAGAGCCTCCCCCCAGGGGATGCTA

CCCCCACCACTACCCTGCCAACAAAGCCAGCAGGAACCACCAGCCGCCCCACAGTGGCCCCACGGGCCACCACTCGTCGGCCCCCCAGACCCCCGGGCTC

TTCCAGGAAGGGGGCTGGTGGTTCGACTCGCACTCTCACACCCGTACCGGGTGGCCACTTGGCCAGGAAGGAAAGCCAGAGGGGACGAAACCAGAGCTCA

GCACATCTGGGGCCGAAGCGTCCTCTGGGGAAGATCTTCCAAATCTACAAGGGTAACTTTACGGGGTCTGCGGAGCCAGACCCCTCCGCGCTCACGCCCA

GGACCCCACTCGGGGGCTACTTCTCTTCGACACAGCCCCAGACAGTGTCTCCAGCTACAGCACCCAGAAGCACCTCACGGGTGCCCCCCACAACTTCCCT

GGTACCTGTAAAGGACAAGCCAGGCTTTATCAGATCCAACCAGGGGAGTGGCCCCATCCTTACCAGCCCAGGAGGGGAGCCAGCTGCCACAGCAGCCACA

GGTGCCCCTGCCAGTACACAGCCTGCCCCAGTGCCTTCTCAGAGCCCTCATGGTGACGTGCAGGACAGCGCCAGCCACAGTGACTCTTGGCTTGCTGTCA

CACCTGACACTGACAGACCCACGTCTGCCAGCTCCGGGGTCTTCACGGCTGCCACAGGGCCCACCCAGGCTGCCTTTGATGCCACTGTCTCAGCCCCTTC

CCCGGGCATCCCTCAGGGACCATCTGCAACCCCTCAGGCCCCAACCCGGCCCTCTGGGGTCTCAGAAAGCACTGTTTCTCCAGCAGAGGAAGAGGCTGAG

GCCTCCCCCACGACAACCGACAGGGGCCCCAGACCTCTCTCCACAGTGCTGTCCACAGCCACGGGCAACTTCCTCAACCGCCTGGTCCCTGCTGGGACCT

GGAAGCCGGGGACTGTGGCCAACATCTCCCACGTGGCTGAAGGGGACAAACCCCAGCACAGAGCCACCATCTGCTTGAGCAAGATGGATATTGCCTGGGT

CATCGTGGCCATCAGTGTCCCCATCTCCTCCTGCT - UNI26507 - - UNI31336 - CGGTCCTGTTGACAGTGTGCTGCATGAGGAGGAAGAAG

AAGACGGCCAACCCTGAGAACAACCTGAGCTACTGGAACAATGCCATCACAATGGACTACTTCAACAGACACGCGGTGGAGCTCCCGAGGGAGATCCAGT

CCCTAGAGACCTCAGAG - UNI28402 - GACCAGCTCTCAGAGCCCCGCTCCCCAGCCAATGGCGACTATCGAGACACTGGGATGGTCCTCGTGAAC

CCCTTCTGCCAGGAAACACTGTTCGTGGGAAACGACCAAGTTTCCGAGATCTAGATGCAGCAGCCTCCGCTTTGCCACTCCCTATTTTTGTCTCTAAATT

ATAAATATACAAATATATATATTATAAATATAACCTTTGTGTAACCCTGACTTAATAAGAGACATTTTCAGCTTTTTTTCCTAAGAATTGTCAACATCTT

TTTTACAAGTGTGGTTTAAAAAAAAAAAAATTTACAGAATGACCCATGGCTTTATAAAATAAAGGTATTTCTAAGCAAAGCGGTTGCACTGATTGCTTCT

CTTAACTGTTCTGGGCATGTAGAGGTTCCAGGAGCCCTGGGCAGATGAGGAAAGAGACCAATCTCCCGTGGAAGCTGAACGTTAGTGTGGCCAAGTGAGT

GGTCATCTGCGTGGTCTTGATGCTCTGGTTCCCAGGACTCAGTGTGCCCTCATCTCCTGTCTTTTTGTATGTATCCTAGTGGTGGGGATAGGGGCACCAC

AGTGGAGGACACAGGCAGGTGGTGTGCAAAACGGAAGGGAACGGTGCCAGCCTGGAGCCTCACTGTAGCATCACTGAATGTCGAGTTTGACAGGATCGGT

GGAGGCCATCAAGAGCCTCCAGCCCCCTTTTATGACCCCACAGGATGCTCCCACCATGCTAGAAGAAACAGGACTGCCTTTGTCTGGCAGGAAAGTGGTC

CCTAGAAACTCTTCTCAGCATCCCTTCTAACATCCCTGCCTGCCCTTGGATGCCCTGCCTCTCTTCCTGGAGGACAGATGCAGATCTCAGCCCTTGCCCT

TCACTGTTCAAGTGTTGGTTGGGATTCAGTATTGCTTTCTCCAAAGGCAATGATATTGTGCTCCATGAGAAACAGGTTTATCTATTAAGCCTTGCAGTGT

AGAACTATTTTTTTTAACCTTCCCCCATTAAATCTTT
Translation
 - UNI13591 - - UNI36359 -  - UNI31336 - - UNI36359 - MKRSLQALYCQLLS - UNI31336 - - UNI36359 - SFLLT

LALTKALVLAVHEPSPRESLQTLPSGSPPGTMVTAPHSPTRLSSVLTLNPTPDGPSSQAAATLETTVSHPEGHPPTDTTSTVMGTAAVPHPESPLPTGSP

PAAMTTTPSHSESLPPGDATPTTTLPTKPAGTTSRPTVAPRATTRRPPRPPGSSRKGAGGSTRTLTPVPGGHLARKESQRGRNQSSAHLGPKRPLGKIFQ

IYKGNFTGSAEPDPSALTPRTPLGGYFSSTQPQTVSPATAPRSTSRVPPTTSLVPVKDKPGFIRSNQGSGPILTSPGGEPAATAATGAPASTQPAPVPSQ

SPHGDVQDSASHSDSWLAVTPDTDRPTSASSGVFTAATGPTQAAFDATVSAPSPGIPQGPSATPQAPTRPSGVSESTVSPAEEEAEASPTTTDRGPRPLS

TVLSTATGNFLNRLVPAGTWKPGTVANISHVAEGDKPQHRATICLSKMDIAWVIVAISVPISSCS - UNI26507 - - UNI31336 - SVLLTVCC

MRRKKKTANPENNLSYWNNAITMDYFNRHAVELPREIQSLETSE - UNI28402 - DQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI

For any suggestions or comments, please send an email to unitrap@crg.es