Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042787 (Endogl1)
Chromosomal location
Chr 9: 119354078 - 119374635 (+)
Description
endonuclease G-like 1 Gene [Source:MGI Symbol;Acc:MGI:2143333]
RefSeq_dna
NM_172456 
RefSeq_peptide
NP_766044.1 
MGI
MGI:2143333 
Uniprot/SWISSPROT
Q8C163 
Human Ortholog
ENSG00000157036 (ENDOGL1)
Omim not available
UniTrap UNI3788
Vector Insertion
Chr 9: 119361461 - 119371493
Public Clones XP0317 (sanger) XL965 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035094
Sequence
AGAGACAAAGTGCTGGCGCCCGCGAGTCATGGCTGCAAAGAGCTTCGCTTCCCGTCTCAGGGACTCGCGGCGATTTCTGAATGGCTTCTTGGCCGGGGCT

GTAGTGGGCGCCGCGGGAGCGGGGCTGACGGCGCTGCAGTTTTTCCGGCGTCCGGACGCGGAATCCGCGAAGCTGGCGAGGCAGCCACACG AATCTGCA

GAAGAAGCTGTCTTGGAACAGTTTGGGTTTCCTTTAGCTGGAACAGAGACGAGGCGTTACACTAACCACGCCCTGTCTTACGATCAGGCAAAACGGGTGC

CCAGATGGGTTCTTGAGCATATATCCAAGGACAAGATCATCG GTGACGCTGACAGAAAGCATTGTAAATTCAAGCCGGATCCTTCTGTCCCTTCAGCCT

TCAGCGCCCTCAATGAAGACTATATCGGGAGTGGCTGGTCACGAGGCCACATGGCCCCGGCAGGAAATAACAAGTTTTCCAGT GAAGCCATGGCAGAAA

CCTTTTACCTTTCTAATATCGTGCCTCAGAATTTTGATAATAACTCCGGCTACTGGAACAG AATAGAAATGTATTGTCGTGAGCTGACGGAGAGATTTG

AAGATGTTTGGATAGTATCAGGACCTTTAACCTTACCTCATACTAGGAATGATGGAACGAAAACAGTTAGTTACCAG - UNI3788 - GTGATTGGTG

AGGACAACGTGGCCGTCCCCTCGCACCTTTACAAGGTGATCCTGGCTCGCAGAAGCCCGGAATCTACGGAGCCGCTGGCGCTGGGGGCCTTTGTGGTGCC

AAATAAAGCCATTGGGTTCCAGTCCCAGTTATCCGAGTTCCAGGTGAGCCTCCATGACCTGGAGAAGATGTCAGGTCTGGTGTTTTTCCCCCGTCTGGAT

AGAAGCAGGGACATCCGGAATATTTGCTCTGTGGACACCTGCAAGCTCCTGGGTTTCCAGGAATTCACTCTGTACCTGAGCACGAGGAAGATTGATGGAG

CCCGGTCTGTGGCCAGACTGGAGAAGGTTCTGGAAGCTTTGAAGAGCTCAGGGGTGGAACCTGACGATTACTTCCTGAGTCGCTATGAGAAAAAGCTGGA

GGAACTGAAGGCTAAGGAGCAAAAGGACGCCCAGCTGGAAAAGCAGTCCTAGTGTCTGTCTCGGTGTGCACTGAGCACCTGTGACCAACAGGTTTATTTT

CAAGAAATGATGGAATTCTGACCAAAATCCTCCAAAGACTCGGGGCTCAAAACTCAGTGTCGTCCTTCTCTGGGATCCGAGGTGGCTGAGATGGTTTTAA

AACTCTGCTCTCACGTGCTCCTTCCCTCATGACCCTGAAGTCCTCCCATCTGTCTGTGTTGGAGAATCCAGTGACTGTTCTTCCTCTGTGCAAACCCTGC

TGTCCCATCTTACCTGTGGGCAAGATGAGGCTCAGAGAACTCTGTATCTTTACCATTGGTATTCAACAGAAGTCATCCAGGGTGCCTCAGAGTCAAGACA

GAGTTAGATGGATGTAACTCAGTCCGTACCTGCATCCACGGCTGTTTCTGGCACTACAGCCCTCCTGGTGAGAAGGGTGTGTCTCTTCTCGCATCATTTC

TGTGGGAAAAAACAGTGGGTCTTGGAAAGATGGAGATGTTTTGTGGGTTTAACCAGAGACTGTGGTTCCCTCCAGGGATCACATGGTGCCAGATAAGTAT

GTTTCTTGCCTCATTGGGGCCTTTCTAAAGGAGCCCAAGAAAGGTGTTTGCCAAGAGTCGCCGGGTACCTCTGGTCCTGCTGTCTGCTGGACCAGCACAC

CACAGGTAGGTATAGCCTGGGCCCAAGGTCCGAACCAGCTCATTGCCTGGGGAAAGAGCAGCTGCTGTCTGTGCTGACCTCCAGACTGGTTTATACAGAT

CTTGAGCTGTCCTGAGTCCATGCGCACAGCCCAGAAGCTTCTGGGCAAAAGGACTCGTCTGAATCTGCCACTCTGCCACTGTCCTCCAAGCAATACGAGA

GTGATCTTTGTGGCATTGTGTTTGCCTCCGATAGAAATGCATGACTTTACAATAAAGACAAGAAGGCTCTGGCTGACCCTCTTCTGCTCCTTCATTTGGA

GAAAAAGAAACTGTCAGGTGTAGGACACAGTGACGGATTAGCTCCGTTCTGCGGTACCTTCCTCTTCCCCATTAACTTGTGCCAGTCCTTCTGAGGATAG

AAAGCCAAAATGTCACCATGACCGAAAAAAAAATCTGTTACTTTCTCTCCTCAGAAAAGAGGTGATGGCGGGGCCTGAGTGTTTCTCCAGCAGCCCTGGG

AAGGAGGCTGAGGCTCCTCCTGCCTGTGCCCCAGGTTCCCACCATGTGTTTATGCAGCCGAGCTCCTCCTCCTGTTGCCGTGCTCTCCTCTGCTGGCCTG

GCTTGCTGCTGGCTTTGGAGTTGCTTCCCACACTCTCCCTACTCAGGAAGAATCTTGTCTGTATCAGAAAGTTTCTGTAGCCTGGGATTTTATTTCTTAT

GGCAGATGCTACCTGGCCATTGTAAGACAGAAATAAGAGCAAACCAAAAAGACAGCACGCCTGACTGCATATTTATTTATTTATTTATTGAATCTGTATT

TCTTATGAGTGTTTTGCCTGTTTGCATCTGTGCATACCACACGAGTGCCTGTTGCCCACAGAGGTTAGAAGAGCTCATTGGATACCCTGGAAATGGAATC

CCAGATGGTTCTGAGCCACCGTGTGAATGCTGGATTCTCTGCAGTTGAATCGGGGTTCTCTGCAAGAGCAGCCAGTGCTCTTGAGCCCCGATCTCAGATT

TTATGTGTGAAATATCTATTGACATATAACACTGATCCTTGAATTGTCCTGTGAACATTTGCATTAAGAGGACCCAAAACAAACACTTAAAATGGCCCCT

CAGTGTGACTGTCCGTTTTTCTGGATTGCAGTGCAGCAGATTCCTGGGCCATACTTGAGTATCAAATGTGTCAGAGGCAGACGTTGTAGCCAGTCAAACC

TGAGTGGGGTCACTGTCTGTTCGTCACCTCAGTGGGCTCCCTCAGGTTCTTGGGCTGAGCCTTCTGGGCCATTCACCCTTCCAGTTCCTGGTCTGAAGAA

ATGACCAGGCTGGGTTGGCTCTGCTGTGGGAAGTCCCTGTCTCGGGGAGGGAGATTTAATTCTTAATCTTTCATCATTTCTAGTGATGTCTTCAAGTTCT

TTGGTCTTTGGACTAAGGCTGTTGGCCAAAGCTGAATACAGCAAAAGCCTTACTGGAAGTTAGAGAGGTTAGGGAGAGGGATGCGAGCCCCTGAACTGCG

CTGCCATTTCTGCTCTTACATCTTAACCAGCAGAGACCTCTACCCTTCTCTTCGGCCTTTGACGAGTGCCCAGCAGGAGAGGCAGTCTGCTCTTGAGGGA

ATGGCTTCCTGCAGAGCTGTGCTCAGTTTGCAGCCTGACACTGGCATGATCCTGTGTGCCTCCATGTCACCTGTGCGCCCTGCCTCATCTGAGAGGGTAT

TGTTGAGCTCACTCCGTTTGTGGCAGACTTCCTGTTAACGGCTTGTGAGGGGTAGGATGTGCCCTGCCAACTGCACCCACAGCCTGTGCACCTGTGAAAG

CCCTGCAGTTCTTGGGAGAGGAGGCCTGACTGGTGGAAGTGGGTCAGTAGAAGCAGGCTTTGAAGGTTAACCCCCTCTCGCTTCGGGCCTGTGTGCTTTG

CTTTCTGTCTGCCGCCATAGAAACATATAAACCTCTGGAGACTGCTGTTCCTGTTGCCCTGCCTCCCATACCATAGTGGACTGGAATCCCAGCGCTGTCG

GATCAAATAAATCCTTCCCGAAGTTGCTTCTG
Translation
MAAKSFASRLRDSRRFLNGFLAGAVVGAAGAGLTALQFFRRPDAESAKLARQPHE ESAEEAVLEQFGFPLAGTETRRYTNHALSYDQAKRVPRWVLEHI

SKDKIIG GDADRKHCKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSS EAMAETFYLSNIVPQNFDNNSGYWNR RIEMYCRELTERFEDVW

IVSGPLTLPHTRNDGTKTVSYQ - UNI3788 - VIGEDNVAVPSHLYKVILARRSPESTEPLALGAFVVPNKAIGFQSQLSEFQVSLHDLEKMSGLVF

FPRLDRSRDIRNICSVDTCKLLGFQEFTLYLSTRKIDGARSVARLEKVLEALKSSGVEPDDYFLSRYEKKLEELKAKEQKDAQLEKQS

For any suggestions or comments, please send an email to unitrap@crg.es