Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042797 (Aqp11)
Chromosomal location
Chr 7: 104874889 - 104886497 (-)
Description
aquaporin 11 Gene [Source:MGI Symbol;Acc:MGI:1913583]
RefSeq_dna
NM_175105 
RefSeq_peptide
NP_780314.1 
MGI
MGI:1913583 
Uniprot/SWISSPROT
Q8BHH1 
Uniprot/SPTREMBL
Q8BYF0 
Human Ortholog
ENSG00000178301 (AQP11)
Omim not available
UniTrap UNI19590
Vector Insertion
Chr 7: 104877598 - 104885878
Public Clones not available
Private Clones OST388295 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24059
Vector Insertion
Chr 7: 104875215 - 104877480
Public Clones not available
Private Clones OST236323 (lexicon) OST6495 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055379
Sequence
ATGTCCGCGCTACTGGGGCTCCGGCCCGAGGTGCAGGACACCTGCATCTCGCTGGGGCTAATGCTGCTGTTCGTGCTGTTCGTGGGGCTGGCCCGCGTGA

TCGCCCGGCAACAGCTACACAGGCCCGTGGTCCACGCCTTCGTCCTGGAGTTTCTAGCTACCTTCCAGCTCTGCTGCTGCACCCACGAGCTCCAAGTGCT

GAGCGAGCAGGACTCTGCGCACCCCACCTGGACTCTGACACTGATCTACTTCTTTTCCTTGGTGCATGGCCTGACCCTGGTGGGCACAGCTAGCAACCCG

TGCGGCGTGATGATGCAGATGATTCTGGGGGGTATGTCCCCCGAAATGGGTGCCGTGAGGTTGTTGGCTCAGCTGGTTAGCGCCCTGTGCAGCAGGTACT

GCATAAGCGCCCTGTGGAGCCTGAGTCTGACCAAGTACCATTACGACGAAAGGATCTTAGCTTGCAGGAATCCCATCCACACCGACATGTCCAAAGCGAT

CATCATAGAGGCCATCTGCTCCTTTATTTTCCACAGCGCTCTACTGCACTTCCAGGAGGTCCGAACCAAGCTTCGCATCCACCTGCTGGCTGCACTCATC

ACCTTTTTGGCCTATGCAG - UNI19590 - - UNI24059 - GTGTGCTGATGATGATCCTCATGTTCAGTTTTTTCCTTCCATGGCTGCATAACA

ATCAAATGACTAATAAAAAAGAGTAACCACTCCCAAAGACTCGAACTAAGTCCCAGGACAGTCAAGCTGGATGCGACAATCTGAGCACCCTCCAAACTCT

GGACGCCTCCTGCTTCAGCTTTCTCTGTGGAAGGTGTCTTAAGTTTTTACTACCTGGACTTCAAATTACTGTGAAAATGAGGTAGCCTGTATTTCTCAAG

TTAAGACTTGTTCTCGAGTGATGTATTAAATGCTGCTAGAAAAGGCTCATTCATTAAACATCTACCTATCCC
Translation
MSALLGLRPEVQDTCISLGLMLLFVLFVGLARVIARQQLHRPVVHAFVLEFLATFQLCCCTHELQVLSEQDSAHPTWTLTLIYFFSLVHGLTLVGTASNP

CGVMMQMILGGMSPEMGAVRLLAQLVSALCSRYCISALWSLSLTKYHYDERILACRNPIHTDMSKAIIIEAICSFIFHSALLHFQEVRTKLRIHLLAALI

TFLAYAG - UNI19590 - - UNI24059 - GVLMMILMFSFFLPWLHNNQMTNKKE
Transcript ENSMUST00000084986
Sequence
ATGTCCGCGCTACTGGGGCTCCGGCCCGAGGTGCAGGACACCTGCATCTCGCTGGGGCTAATGCTGCTGTTCGTGCTGTTCGTGGGGCTGGCCCGCGTGA

TCGCCCGGCAACAGCTACACAGGCCCGTGGTCCACGCCTTCGTCCTGGAGTTTCTAGCTACCTTCCAGCTCTGCTGCTGCACCCACGAGCTCCAAGTGCT

GAGCGAGCAGGACTCTGCGCACCCCACCTGGACTCTGACACTGATCTACTTCTTTTCCTTGGTGCATGGCCTGACCCTGGTGGGCACAGCTAGCAACCCG

TGCGGCGTGATGATGCAGATGATTCTGGGGGGTATGTCCCCCGAAATGGGTGCCGTGAGGTTGTTGGCTCAGCTGGTTAGCGCCCTGTGCAGCAGGTACT

GCATAAGCGCCCTGTGGAGCCTGAGTCTGACCAAGTACCATTACGACGAAAGGATCTTAGCTTGCAGGAATCCCATCCACACCGACATGTCCAAAGCGAT

CATCATAGAGGCCATCTGCTCCTTTATTTTCCACAGCGCTCTACTGCACTTCCAGGAGGTCCGAACCAAGCTTCGCATCCACCTGCTGGCTGCACTCATC

ACCTTTTTGGCCTATGCAG - UNI19590 - GAGGGAGCCTCACAGGAGCATTGTTTAACCCAGCGCTGGCACTTTCTCTGCACTTTCCGTGCTTTGA

CGAACTCTTCTATAAGTTTTTTGTAGTATACTGGCTTGCTCCTTCTGTAG - UNI24059 - GTGTGCTGATGATGATCCTCATGTTCAGTTTTTTCC

TTCCATGGCTGCATAACAATCAAATGACTAATAAAAAAGAGTAACCACTCCCAAAGACTCGAACTAAGTCCCAGGACAGTCAAGCTGGATGCGACAATCT

GAGCACCCTCCAAACTCTGGACGCCTCCTGCTTCAGCTTTCTCTGTGGAAGGTGTCTTAAGTTTTTACTACCTGGACTTCAAATTACTGTGAAAATGAGG

TAGCCTGTATTTCTCAAGTTAAGACTTGTTCTCGAGTGATGTATTAAATGCTGCTAGAAAAGGCTCATTCATTAAACATCTACCTATCCC
Translation
MSALLGLRPEVQDTCISLGLMLLFVLFVGLARVIARQQLHRPVVHAFVLEFLATFQLCCCTHELQVLSEQDSAHPTWTLTLIYFFSLVHGLTLVGTASNP

CGVMMQMILGGMSPEMGAVRLLAQLVSALCSRYCISALWSLSLTKYHYDERILACRNPIHTDMSKAIIIEAICSFIFHSALLHFQEVRTKLRIHLLAALI

TFLAYAG - UNI19590 - GGSLTGALFNPALALSLHFPCFDELFYKFFVVYWLAPSVG - UNI24059 - GVLMMILMFSFFLPWLHNNQMTNKK

E

For any suggestions or comments, please send an email to unitrap@crg.es